CF832427

Overview
NameCF832427
Unique NameCF832427
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length412
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5602 contig Csv1_Contig5602:180..591. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF832427 vs. ExPASy Swiss-Prot
Match: YB83_SCHPO (LisH domain-containing protein C29A3.03c OS=Schizosaccharomyces pombe GN=SPBC29A3.03c PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 6.809e-12
Identity = 27/54 (50.00%), Postives = 43/54 (79.63%), Query Frame = 3
Query:    3 KEQTSDDNPPMIMSCGHVLCRQSINKMSKNHSRTFKCPYCPSDIDAAQCRQLNF 164
            KEQ +++NPPM+MSCGHV+ ++S+ ++S+N S+ FKCPYCP++  AA   ++ F
Sbjct:  345 KEQATEENPPMMMSCGHVIVKESLRQLSRNGSQRFKCPYCPNENVAADAIRVYF 398          
The following BLAST results are available for this feature:
BLAST of CF832427 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
YB83_SCHPO6.809e-1250.00LisH domain-containing protein C29A3.03c OS=Schizo... [more]
back to top
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS02_01N14_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01N14, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832427 ID=CF832427|Name=CF832427|organism=Citrus sinensis|type=EST|length=412bp
CAAAAGAGCAAACGTCTGACGATAACCCTCCAATGATCATGTCCTGCGGC
CATGTGCTCTGCCGGCAGTCAATTAACAAAATGTCAAAGAACCACTCAAG
GACATTCAAGTGCCCATACTGTCCATCTGATATTGATGCAGCACAGTGTC
GGCAGCTGAATTTCTGATGCATGCCATGCCTTGATATGTACAATGGGTTG
TATTTAACACTTGCCTTTCTTGTCTGAACAAACTTTTTTAGGTTTAAAAG
AATCTGATGTTGTGTTATTTTGTATTGTGTTGTCTTATGTAGCCAGGGGT
AGCGTATGATGCTGGTGGCTGCAAAAAGCTGGTCTGTTGTATAACTGTTA
AATGATACATTTGTTGTAAATAGAAATTCTTGCGGCGTGGGATTCAAAAA
AAAAAAAAAAGA
back to top