CF832448

Overview
NameCF832448
Unique NameCF832448
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length505
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1014 contig Csv1_Contig1014:1..505. BLAST: Citrus Unigene V1 Contigs to SwissProt
Homology
BLAST of CF832448 vs. ExPASy Swiss-Prot
Match: TN5P_ECOLX (Transposase for transposon Tn5 OS=Escherichia coli GN=tnpA PE=1 SV=1)

HSP 1 Score: 336.65 bits (862), Expect = 3.810e-92
Identity = 168/168 (100.00%), Postives = 168/168 (100.00%), Query Frame = 2
Query:    2 KLAHNERFVVRSKHPRKDVESGLYLYDHLKNQPELGGYQISIPQKGVVDKRGKRKNRPARKASLSLRSGRITLKQGNITLNAVLAEEINPPKGETPLKWLLLTSEPVESLAQALRVIDIYTHRWRIEEFHKAWKTGAGAERQRMEEPDNLERMVSILSFVAVRLLQLR 505
            KLAHNERFVVRSKHPRKDVESGLYLYDHLKNQPELGGYQISIPQKGVVDKRGKRKNRPARKASLSLRSGRITLKQGNITLNAVLAEEINPPKGETPLKWLLLTSEPVESLAQALRVIDIYTHRWRIEEFHKAWKTGAGAERQRMEEPDNLERMVSILSFVAVRLLQLR
Sbjct:  200 KLAHNERFVVRSKHPRKDVESGLYLYDHLKNQPELGGYQISIPQKGVVDKRGKRKNRPARKASLSLRSGRITLKQGNITLNAVLAEEINPPKGETPLKWLLLTSEPVESLAQALRVIDIYTHRWRIEEFHKAWKTGAGAERQRMEEPDNLERMVSILSFVAVRLLQLR 367          
The following BLAST results are available for this feature:
BLAST of CF832448 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
TN5P_ECOLX3.810e-92100.00Transposase for transposon Tn5 OS=Escherichia coli... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_01O01_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01O01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832448 ID=CF832448|Name=CF832448|organism=Citrus sinensis|type=EST|length=505bp
CAAACTGGCGCATAACGAGCGCTTCGTGGTGCGCTCCAAGCACCCACGCA
AGGACGTAGAGTCTGGGTTGTATCTGTACGACCATCTGAAGAACCAACCG
GAGTTGGGTGGCTATCAGATCAGCATTCCGCAAAAGGGCGTGGTGGATAA
ACGCGGTAAACGTAAAAATCGACCAGCCCGCAAGGCGAGCTTGAGCCTGC
GCAGTGGGCGCATCACGCTAAAACAGGGGAATATCACGCTCAACGCGGTG
CTGGCCGAGGAGATTAACCCGCCCAAGGGTGAGACCCCGTTGAAATGGTT
GTTGCTGACCAGCGAACCGGTCGAGTCGCTAGCCCAAGCCTTGCGCGTCA
TCGACATTTATACCCATCGCTGGCGGATCGAGGAGTTCCATAAGGCATGG
AAAACCGGAGCAGGAGCCGAGAGGCAACGCATGGAGGAGCCGGATAATCT
GGAGCGGATGGTCTCGATCCTCTCGTTTGTTGCGGTCAGGCTGTTACAGC
TCAGA
back to top