CF832453

Overview
NameCF832453
Unique NameCF832453
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length768
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6148 contig Csv1_Contig6148:515..1277. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF832453 vs. ExPASy Swiss-Prot
Match: CLH1_CITUN (Chlorophyllase-1, chloroplastic OS=Citrus unshiu PE=2 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 1.411e-49
Identity = 92/157 (58.60%), Postives = 112/157 (71.34%), Query Frame = -2
Query:  264 ALVGIDPVAGLASVHSELEPPILSHDSFEFSIPXXXXXXXXXXXTKCMQPCAPENKNHEQFFKRCTYSDHAHFDAKDYGHMDILDDNPQGPKNWAISKFLCTNGKKPRDPMRRCVAGIAAAFLKAYFDGDCEDFRTMLKDPSLAPIELDEVEFIPAA 734
            A++G+DPVAG +   + L+P ILS DSF+FSIP            +C+  CAPE  NHE+FF RC  S  AHF A DYGHMDILDDNP   K+WA+SK+ C NG + RDPMRRCV+GI  AFLK +FDGD EDFR +LKDPS API+LD VE+I A+
Sbjct:  164 AVIGLDPVAGTSKT-TGLDPSILSFDSFDFSIPVTVIGTGLGGVARCITACAPEGANHEEFFNRCKNSSRAHFVATDYGHMDILDDNPSDVKSWALSKYFCKNGNESRDPMRRCVSGIVVAFLKDFFDGDAEDFRQILKDPSFAPIKLDSVEYIDAS 319          
BLAST of CF832453 vs. ExPASy Swiss-Prot
Match: CLH1_CITSI (Chlorophyllase-1, chloroplastic OS=Citrus sinensis GN=CHLASE1 PE=1 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 1.560e-48
Identity = 91/157 (57.96%), Postives = 111/157 (70.70%), Query Frame = -2
Query:  264 ALVGIDPVAGLASVHSELEPPILSHDSFEFSIPXXXXXXXXXXXTKCMQPCAPENKNHEQFFKRCTYSDHAHFDAKDYGHMDILDDNPQGPKNWAISKFLCTNGKKPRDPMRRCVAGIAAAFLKAYFDGDCEDFRTMLKDPSLAPIELDEVEFIPAA 734
            A++G+DPVAG +   + L+P ILS DSF+FSIP            +C+  CAPE  NHE+FF RC  S  AHF A DYGHMDILDDNP   K+WA+SK+ C NG + RDPMRRCV+GI  AFLK +F GD EDFR +LKDPS API+LD VE+I A+
Sbjct:  164 AVIGLDPVAGTSKT-TGLDPSILSFDSFDFSIPVTVIGTGLGGVARCITACAPEGANHEEFFNRCKNSSRAHFVATDYGHMDILDDNPSDVKSWALSKYFCKNGNESRDPMRRCVSGIVVAFLKDFFYGDAEDFRQILKDPSFAPIKLDSVEYIDAS 319          
BLAST of CF832453 vs. ExPASy Swiss-Prot
Match: CLH1_ARATH (Chlorophyllase-1 OS=Arabidopsis thaliana GN=CLH1 PE=1 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 3.499e-24
Identity = 66/157 (42.04%), Postives = 93/157 (59.24%), Query Frame = -2
Query:  288 SIKISALVGIDPVAGLASVHSELEPPILSH--DSFEFSIPXXXXXXXXXXXTK-CMQPCAPENKNHEQFFKRCTYSDHAHFDAKDYGHMDILDDNPQGPKNWAISKFLCTNGKKPRDPMRRCVAGIAAAFLKAYFDGDCEDFRTMLKDPSLAPIELD 749
            SI  SAL+GIDPVAG  + +   +P IL++  +SFE  IP               M PCAP + NHE+F+K C  +  AHF A DYGHMD+LDD+  G   + ++  +C NG++ +  MR  V GI  AFLK    G+  + R ++KDPS++P +LD
Sbjct:  158 SITFSALIGIDPVAG-TNKYIRTDPHILTYKPESFELDIPVAVVGTGLGPKWNNVMPPCAPTDLNHEEFYKECK-ATKAHFVAADYGHMDMLDDDLPGFVGF-MAGCMCKNGQRKKSEMRSFVGGIVVAFLKYSLWGEKAEIRLIVKDPSVSPAKLD 311          
BLAST of CF832453 vs. ExPASy Swiss-Prot
Match: CLH2_ARATH (Chlorophyllase-2, chloroplastic OS=Arabidopsis thaliana GN=CLH2 PE=1 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 6.828e-20
Identity = 64/166 (38.55%), Postives = 90/166 (54.22%), Query Frame = -2
Query:  273 SIKISALVGIDPVAGLASVHSELEPPILSH--DSFEFS---IPXXXXXXXXXXXTKCMQPCAPENKNHEQFFKRCTYSDHAHFDAKDYGHMDILDDNPQGPKNWAISKFLCTNGKKPRDPMRRCVAGIAAAFLKAYFDGDCEDFRTMLKD--PSLAPIELDEVEFI 749
            ++KIS L+GIDPV G      +  PP+L++  +SF+     I                 PCAP   NH +FF+ C      HF AKDYGH+D+LDD+ +G +  + S  LC NG++ R PMRR V G+  +FLKAY +GD  +    +KD      P+E+ E E I
Sbjct:  157 NLKISTLIGIDPVDGTGK-GKQTPPPVLAYLPNSFDLDKTPILVIGSGLGETARNPLFPPCAPPGVNHREFFRECQ-GPAWHFVAKDYGHLDMLDDDTKGIRGKS-SYCLCKNGEE-RRPMRRFVGGLVVSFLKAYLEGDDREL-VKIKDGCHEDVPVEIQEFEVI 317          
BLAST of CF832453 vs. ExPASy Swiss-Prot
Match: CLH0_CHEAL (Chlorophyllase type 0 OS=Chenopodium album GN=CACLH PE=1 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.574e-16
Identity = 56/160 (35.00%), Postives = 83/160 (51.88%), Query Frame = -2
Query:  291 TNPPVSIKISALVGIDPVAGLASVHSELEPPILSH--DSFEFSIPXXXXXXXXXXXTKCMQPCAPENKNHEQFFKRCTYSDHAHFDAKDYGHMDILDDNPQGPKNWAISKFLCTNGKKPRDPMRRCVAGIAAAFLKAYFDGDCEDFRTMLKDPSLAPIEL 764
            +N  + +  SAL+G+DPVAG  SV     P +L++  +SF  SIP           T     CAP + +H+QF+  C   + +HF    YGHMD+L++    P    +S  +C    +P+  MRR + GI  AFL AYF  D   +  ++ + SLAP  L
Sbjct:  176 SNIKLDVTFSALIGVDPVAG-RSVDDRTLPHVLTYKPNSFNLSIPVTVIGSGLGNHTIS---CAPNHVSHQQFYDECK-ENSSHFVITKYGHMDMLNEFRLSPIAVTMS-LMCAQSFRPKATMRRTLGGIMVAFLNAYFRDDGRQYYAIIANRSLAPTNL 329          
The following BLAST results are available for this feature:
BLAST of CF832453 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
CLH1_CITUN1.411e-4958.60Chlorophyllase-1, chloroplastic OS=Citrus unshiu P... [more]
CLH1_CITSI1.560e-4857.96Chlorophyllase-1, chloroplastic OS=Citrus sinensis... [more]
CLH1_ARATH3.499e-2442.04Chlorophyllase-1 OS=Arabidopsis thaliana GN=CLH1 P... [more]
CLH2_ARATH6.828e-2038.55Chlorophyllase-2, chloroplastic OS=Arabidopsis tha... [more]
CLH0_CHEAL1.574e-1635.00Chlorophyllase type 0 OS=Chenopodium album GN=CACL... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_01O05_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01O05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832453 ID=CF832453|Name=CF832453|organism=Citrus sinensis|type=EST|length=768bp
TTTTTTTTTTTTTTTTTAAGCTTGAGAGACGTGAATACTAGTTTATTTTG
AATGTAGAAGAAACTGCTGACAAAGAAACCAAATACAGTAATAAACAACA
TGATCATTACTTAAAAGGTCATCCTAAGCAAGGCTCATTATGTCCCGTTA
TTATATATTATTTAGTTTTTCTAAGCTTTCCCTCATTTCTGAGAAGTTTA
CCGCCCAAAATGGAAAGTGCATATGAGCCAAATGGGTAGGTGCAGTGGTT
AAGCTTTTGCACGAGCTGCGGGAATGAACTCAACCTCATCAAGCTCTATC
GGAGCAAGAGAAGGGTCTTTCAACATTGTCCTGAAATCCTCACAATCACC
ATCAAAATAGGCCTTCAAAAAAGCCGCAGCAATGCCAGCAACACATCTCC
TCATGGGATCCCTTGGTTTCTTTCCATTCGTGCACAAAAATTTTGAAATT
GCCCAATTCTTTGGTCCCTGGGGATTATCATCTAAAATGTCCATGTGACC
ATAATCCTTAGCATCAAAATGAGCATGATCTGAATATGTACACCTCTTGA
AAAATTGCTCATGGTTTTTGTTTTCCGGTGCACAAGGCTGCATGCACTTT
GTCACACCACCGAGTCCGGTGCCAATTACAGTAACAGGAATTGAGAACTC
GAATGAGTCATGACTGAGAATCGGGGGTTCAAGTTCACTATGAACGCTGG
CTAACCCGGCAACTGGGTCTATGCCTACTAATGCTGAAATTTTAATGCTA
ACTGGAGGATTTGTTGCA
back to top