CF833826
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CF833826 vs. ExPASy Swiss-Prot
Match: PAPSS_URECA (Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase OS=Urechis caupo PE=2 SV=1) HSP 1 Score: 76.6406 bits (187), Expect = 4.556e-14 Identity = 32/54 (59.26%), Postives = 42/54 (77.78%), Query Frame = -3 Query: 266 YDKTQGKMAFFDPSRGQEFLFISGTKMRTLARSKENPPDGFMSPGGWKVLVESY 427 Y+KT+ M F+DP R EF+FISGTKMR +AR+ E PP+GFM+P WK++VE Y Sbjct: 550 YNKTKSAMDFYDPERHDEFMFISGTKMRGMARAGETPPNGFMAPSAWKIMVEYY 603
BLAST of CF833826 vs. ExPASy Swiss-Prot
Match: PAPS2_HUMAN (Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2 OS=Homo sapiens GN=PAPSS2 PE=1 SV=2) HSP 1 Score: 75.0998 bits (183), Expect = 1.326e-13 Identity = 34/57 (59.65%), Postives = 42/57 (73.68%), Query Frame = -3 Query: 257 YDKTQGKMAFFDPSRGQEFLFISGTKMRTLARSKENPPDGFMSPGGWKVLVESYDSM 427 Y+K + M F+DP+R EF FISGT+MR LAR ENPPDGFM+P WKVL + Y S+ Sbjct: 555 YNKAKKAMDFYDPARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSL 611
BLAST of CF833826 vs. ExPASy Swiss-Prot
Match: PAPS2_MOUSE (Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2 OS=Mus musculus GN=Papss2 PE=1 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 3.857e-13 Identity = 33/57 (57.89%), Postives = 43/57 (75.44%), Query Frame = -3 Query: 257 YDKTQGKMAFFDPSRGQEFLFISGTKMRTLARSKENPPDGFMSPGGWKVLVESYDSM 427 Y+K + M F+DP+R +EF FISGT+MR LAR E+PPDGFM+P WKVL + Y S+ Sbjct: 561 YNKIKKAMDFYDPARHEEFDFISGTRMRKLAREGEDPPDGFMAPKAWKVLTDYYRSL 617
BLAST of CF833826 vs. ExPASy Swiss-Prot
Match: PAPS1_MOUSE (Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1 OS=Mus musculus GN=Papss1 PE=2 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 8.043e-11 Identity = 29/60 (48.33%), Postives = 41/60 (68.33%), Query Frame = -3 Query: 248 YDKTQGKMAFFDPSRGQEFLFISGTKMRTLARSKENPPDGFMSPGGWKVLVESYDSMTPA 427 Y+K + +M ++D ++F FISGT+MR LAR + PP+GFM+P W VLVE Y S+ A Sbjct: 565 YNKKKKRMDYYDSEHHEDFEFISGTRMRKLAREGQKPPEGFMAPKAWTVLVEYYKSLEKA 624 The following BLAST results are available for this feature:
BLAST of CF833826 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 4
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CF833826 ID=CF833826; Name=CF833826; organism=Citrus sinensis; type=EST; length=432bpback to top |