CF834597

Overview
NameCF834597
Unique NameCF834597
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length746
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF834597 vs. ExPASy Swiss-Prot
Match: ASP_THECC (21 kDa seed protein OS=Theobroma cacao GN=ASP PE=2 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 4.969e-20
Identity = 60/174 (34.48%), Postives = 94/174 (54.02%), Query Frame = -2
Query:  245 DIIGNKVKSTLEYKLIPVLDGAGGFSTPLG--TNGQCPLDVIQLSSPSERGDNLRLLPSDNYK-IVKVSPDVNLRFPVKVSVKPCNEEPLWKVDSYDDPL----IVTGGSEGHPGAETLLNWFKIEKAGNFSYGGVYNIVHCPSVCLSCPRRCNKIGVSTKDGVRRLLLVGDHE 745
            D  G+++++ ++Y ++  + GAGG    LG  T   CP  V+Q  S  + G  +    +D+   +V+VS DVN+ F V +  + C+   +W++D+YD+      + T G +G PG  TL +WFKIEKAG       Y    CPSVC SC   C+ IG  + D  +  L + D+E
Sbjct:   33 DTDGDELQTGVQYYVLSSISGAGGGGLALGRATGQSCPEIVVQRRSDLDNGTPVIFSNADSKDDVVRVSTDVNIEF-VPIRDRLCSTSTVWRLDNYDNSAGKWWVTTDGVKGEPGPNTLCSWFKIEKAGVLG----YKFRFCPSVCDSCTTLCSDIGRHSDDDGQIRLALSDNE 201          
BLAST of CF834597 vs. ExPASy Swiss-Prot
Match: MIRA_RICDU (Miraculin OS=Richadella dulcifica PE=1 SV=3)

HSP 1 Score: 95.9005 bits (237), Expect = 2.466e-19
Identity = 60/176 (34.09%), Postives = 90/176 (51.14%), Query Frame = -2
Query:  251 DIIGNKVKSTLEYKLIPVLDGAGGFSTPLGT--NGQ--CPLDVIQLSSPSERGDNLRLLPSDNYK-IVKVSPDVNLRFPVKVSVKPCN--EEPLWKVDSYDDP----LIVTGGSEGHPGAETLLNWFKIEKAGNFSYGGVYNIVHCPSVCLSCPRRCNKIGVSTKDGVRRLLLVGD 745
            DI G K+++   Y ++PVL   GG  T   T  NG   CP  V+Q     +    L   P +  + +V+VS D+N+ F    +  PC      +W++D YD+      +  GG +G+PG ET+ +WFKIE+   F   G Y +V CP+VC SC  +C  +G+      RR L + D
Sbjct:   38 DIDGEKLRTGTNYYIVPVLRDHGGGLTVSATTPNGTFVCPPRVVQTRKEVDHDRPLAFFPENPKEDVVRVSTDLNINFS---AFMPCRWTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEE---FCGSGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALSD 207          
BLAST of CF834597 vs. ExPASy Swiss-Prot
Match: LSPI_CARPA (Latex serine proteinase inhibitor OS=Carica papaya PE=1 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 3.813e-12
Identity = 57/175 (32.57%), Postives = 87/175 (49.71%), Query Frame = -2
Query:  251 DIIGNKVKSTLEYKLIPVLDGAGGFSTPL---GTNGQCPLDVIQLSSPSERGDNLRLLPSDNYK--IVKVSPDVNLRFPVKVSVKPCNEEPLWKVDSYDDPL---IVTGGSEGHPGAETLLNWFKIEKAG-NFSYGGVYNIVHCPSVCLSCPRRCNKIGV-STKDGVRRLLLVGD 745
            DI G  V   ++Y ++  + GAGG    +   G   +CPL V+Q   P + G+ +      N K  IV  S D+N++F + ++   CNE   WKVD +   +   +  GG +G+ G E+  + FKI+KAG  FS    Y    CPS   +    CN + +   K  +RRL+L  D
Sbjct:    8 DIDGKPVLYGVDYFVVSAIWGAGGGGLTVYGPGNKKKCPLSVVQ--DPFDNGEPIIFSAIKNVKDNIVFESVDLNVKFNITIN---CNETTAWKVDRFPGVIGWTVTLGGEKGYHGFESTHSMFKIKKAGLPFS----YKFHFCPSYPRTRLIPCNNVDIFFDKYRIRRLILTND 173          
BLAST of CF834597 vs. ExPASy Swiss-Prot
Match: SPI2_SOLTU (Serine protease inhibitor 2 OS=Solanum tuberosum PE=1 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 2.472e-11
Identity = 56/185 (30.27%), Postives = 93/185 (50.27%), Query Frame = -2
Query:  224 DIIGNKVKSTLEYKLIPVLDGAGGFSTPLG----TNGQCPLDVIQLSSP-SERGDNLRLLPSDNY--KIVKVSPDVNLRFPVKVSVKPCNEEPLWKVDSYDDPL----IVTGGSEGHPGAETLLNWFKIEKAGNFSYGGVYNIVHCPSVCLSCPRRCNKIGVSTKDGVRRLLLVGDHEPALNVLF 745
            D+ G ++ S L Y++I    GA G    LG    ++  C   + + +S     G  +R + S ++  + +  +  +N++F +  S K C    +WKV  YD  L    + TGG+ G   +    +WFKI K+    Y    N+++CP    S  + C+K+GV  ++G RRL LV  +E  L+VLF
Sbjct:   10 DVTGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGIFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQFAISTS-KLCVSYTIWKVGDYDASLGTMLLETGGTIGQADS----SWFKIVKSSQLGY----NLLYCPVTSSSDDQFCSKVGVVHQNGKRRLALV--NENPLDVLF 183          
BLAST of CF834597 vs. ExPASy Swiss-Prot
Match: SPI7_SOLTU (Serine protease inhibitor 7 OS=Solanum tuberosum PE=1 SV=2)

HSP 1 Score: 67.3958 bits (163), Expect = 9.392e-11
Identity = 55/183 (30.05%), Postives = 92/183 (50.27%), Query Frame = -2
Query:  248 DIIGNKVKSTLEYKLIPVLDGAGGFSTPLG----TNGQCPLDVIQLSSP-SERGDNLRLLPSDNY--KIVKVSPDVNLRFPVKVSVKPCNEEPLWKVDSYDDPL----IVTGGSEGHPGAETLLNWFKIEKAGNFSYGGVYNIVHCP-SVCLSCP-----RRCNKIGVSTKDGVRRLLLVGDH 745
            D+ G ++ S L Y++I    GA G    LG    ++  C   + + +S     G  +R + S ++  + +  +  +N++F +  S K C    +WKV  YD  L    + TGG+ G   +    +WFKI K+  F Y    N+++CP +  +SCP     + C K+GV  ++G RRL LV D+
Sbjct:   38 DVAGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGIFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQFAISTS-KLCVSYTIWKVGDYDASLGTMLLETGGTIGQADS----SWFKIVKSSQFGY----NLLYCPVTSTMSCPFSSDDQFCLKVGVVHQNGKRRLALVKDN 211          
The following BLAST results are available for this feature:
BLAST of CF834597 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
ASP_THECC4.969e-2034.4821 kDa seed protein OS=Theobroma cacao GN=ASP PE=2... [more]
MIRA_RICDU2.466e-1934.09Miraculin OS=Richadella dulcifica PE=1 SV=3[more]
LSPI_CARPA3.813e-1232.57Latex serine proteinase inhibitor OS=Carica papaya... [more]
SPI2_SOLTU2.472e-1130.27Serine protease inhibitor 2 OS=Solanum tuberosum P... [more]
SPI7_SOLTU9.392e-1130.05Serine protease inhibitor 7 OS=Solanum tuberosum P... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_05M21_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa05M21, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF834597 ID=CF834597; Name=CF834597; organism=Citrus sinensis; type=EST; length=746bp
TTTTTTTTTTTTTTTTTATTTTTTAACAACAGCAAAAGGATCCCTTGCGG
GGTTATTTTTATTCTGTAATAAAGATAAAAGGTCCCTACCCGTGGTCTAT
TATTTAAAATGATACAGCTAAGTTCATTCATTACGCGGTCATTGATATTG
CTTCAGCAGCTTCAAAAAACCTTGATATTGCGTTAGCAGCTTGAAGTAGC
CTTGAGCTTTCCTCTGATGGAAAAAACAGAACATTCAAAGCCGGTTCATG
ATCACCAACTAAAAGCAGACGTCGAACGCCATCCTTAGTTGAAACGCCAA
TTTTGTTGCAGCGTCTAGGACAAGATAGACAGACACTCGGACAATGGACA
ATATTGTATACCCCACCATATGAAAAATTTCCAGCTTTCTCAATCTTAAA
CCAATTTAGCAACGTTTCAGCTCCTGGGTGGCCCTCACTTCCGCCGGTTA
CAATTAATGGATCGTCATAGCTATCAACTTTCCACAATGGTTCTTCATTA
CAGGGCTTAACAGAAACTTTTACGGGGAATCTCAGGTTGACATCAGGGGA
TACCTTGACAATTTTGTAATTGTCGGACGGAAGTAATCTTAAATTATCTC
CCCTTTCGCTAGGAGAACTTAATTGGATAACGTCCAAGGGACACTGTCCA
TTTGTGCCTAGGGGTGTGCTGAATCCACCGGCGCCATCTAGGACTGGGAT
AAGTTTATACTCGAGGGTGGATTTGACCTTGTTGCCAATGATATCT
back to top