CF834937

Overview
NameCF834937
Unique NameCF834937
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length728
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7725 contig Csv1_Contig7725:508..1235. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF834937 vs. ExPASy Swiss-Prot
Match: PSBO_TOBAC (Oxygen-evolving enhancer protein 1, chloroplastic OS=Nicotiana tabacum GN=PSBO PE=2 SV=1)

HSP 1 Score: 365.155 bits (936), Expect = 2.082e-100
Identity = 180/193 (93.26%), Postives = 186/193 (96.37%), Query Frame = -3
Query:  148 PTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLAGGERVPFLFTIKQLVASGKPENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE 726
            PTSFTVKAE VNKNAPPDFQ TKLMTRLTYTLDEIEGPFEVS DGT+KF EKDGIDYAAVTVQL GGERVPFLFTIKQLVASGKPE+F GEFLVPSYRGSSFLDPKGRGGSTGYDNA+ALPAGGRGDEE+L KEN+KNTSSSTGKITLSVT+SKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE
Sbjct:  140 PTSFTVKAESVNKNAPPDFQKTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKNTSSSTGKITLSVTQSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE 332          
BLAST of CF834937 vs. ExPASy Swiss-Prot
Match: PSBO_SOLLC (Oxygen-evolving enhancer protein 1, chloroplastic OS=Solanum lycopersicum GN=PSBO PE=2 SV=2)

HSP 1 Score: 360.918 bits (925), Expect = 3.926e-99
Identity = 177/193 (91.71%), Postives = 186/193 (96.37%), Query Frame = -3
Query:  148 PTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLAGGERVPFLFTIKQLVASGKPENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE 726
            PTSFTVKAEGV+KN+ PDFQ TKLMTRLTYTLDEIEGPFEVSPDGT+KF EKDGIDYAAVTVQL GGERVPFLFTIKQLVASGKPE+F GEFLVPSYRGSSFLDPKGRGGSTGYDNA+ALPAGGRGDEE+L KEN+KNT+S TGKITLSVT+SKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE
Sbjct:  137 PTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKNTASLTGKITLSVTQSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE 329          
BLAST of CF834937 vs. ExPASy Swiss-Prot
Match: PSBO_FRIAG (Oxygen-evolving enhancer protein 1, chloroplastic OS=Fritillaria agrestis GN=PSBO PE=2 SV=1)

HSP 1 Score: 356.681 bits (914), Expect = 7.404e-98
Identity = 172/193 (89.12%), Postives = 184/193 (95.34%), Query Frame = -3
Query:  148 PTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLAGGERVPFLFTIKQLVASGKPENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE 726
            PTSFTVKAEG+NKNAPP+FQ TKLMTRLTYTLDEIEGPFEV+PDGT+KF EKDGIDYAAVTVQL GGERVPFLFT+KQLVA+GKPE+F G +LVPSYRGSSFLDPKGRGGS GYDNA+ALPAGGRGDEE+L KENIK+ SSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLG+K PKDVKIQGIWYAQLE
Sbjct:  137 PTSFTVKAEGINKNAPPEFQKTKLMTRLTYTLDEIEGPFEVAPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVATGKPESFSGSYLVPSYRGSSFLDPKGRGGSAGYDNAVALPAGGRGDEEELVKENIKDVSSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGSKAPKDVKIQGIWYAQLE 329          
BLAST of CF834937 vs. ExPASy Swiss-Prot
Match: PSBO_SOLTU (Oxygen-evolving enhancer protein 1, chloroplastic OS=Solanum tuberosum GN=PSBO PE=2 SV=1)

HSP 1 Score: 350.517 bits (898), Expect = 5.306e-96
Identity = 171/193 (88.60%), Postives = 182/193 (94.30%), Query Frame = -3
Query:  148 PTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLAGGERVPFLFTIKQLVASGKPENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE 726
            PTSFTVKAEGV+KN+ PDFQ TKLMTRLTYTLDEIEGPFEVSPDGT+KF EKDGIDYAAVTVQL GGERVPFLFTIKQLVASGKPE+F  +FLVPSYRGSSFLDPKGRGGSTGYDNA+ALPAGGRGDEE+L KEN+KNT+S TGKIT +VTKS P+TGEVIGVFESIQPSDTDLGAK PKDVKIQGIWYAQLE
Sbjct:  140 PTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSVDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKNTASLTGKITFTVTKSNPQTGEVIGVFESIQPSDTDLGAKTPKDVKIQGIWYAQLE 332          
BLAST of CF834937 vs. ExPASy Swiss-Prot
Match: PSBO2_ARATH (Oxygen-evolving enhancer protein 1-2, chloroplastic OS=Arabidopsis thaliana GN=PSBO2 PE=1 SV=1)

HSP 1 Score: 346.665 bits (888), Expect = 7.662e-95
Identity = 164/193 (84.97%), Postives = 183/193 (94.82%), Query Frame = -3
Query:  148 PTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLAGGERVPFLFTIKQLVASGKPENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE 726
            PTSFTVKA+ V+KNAPPDFQNTKLMTRLTYTLDEIEGPFEV  DG++KF E+DGIDYAAVTVQL GGERVPFLFT+KQL ASGKPE+F G+FLVPSYRGSSFLDPKGRGGSTGYDNA+ALPAGGRGDEE+L+KEN+KNT++S G+ITL +TKSKPETGEVIGVFES+QPSDTDLGAKVPKDVKIQG+WY Q+E
Sbjct:  139 PTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEVGSDGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLEASGKPESFSGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGEITLKITKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQIE 331          
BLAST of CF834937 vs. ExPASy Swiss-Prot
Match: PSBO_SPIOL (Oxygen-evolving enhancer protein 1, chloroplastic OS=Spinacia oleracea GN=PSBO PE=1 SV=1)

HSP 1 Score: 346.28 bits (887), Expect = 1.001e-94
Identity = 168/194 (86.60%), Postives = 181/194 (93.30%), Query Frame = -3
Query:  145 PTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLAGGERVPFLFTIKQLVASGKPENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLEQ 726
            PT F VKAEG++KN+ PDFQNTKLMTRLTYTLDEIEGPFEVS DGT+KF EKDGIDYAAVTVQL GGERVPFLFTIKQLVASGKPE+F G+FLVPSYRGSSFLDPKGRGGSTGYDNA+ALPAGGRGDEE+L KEN KN +SS G ITLSVT SKPETGEVIGVF+S+QPSDTDLGAKVPKDVKI+G+WYAQLEQ
Sbjct:  138 PTKFAVKAEGISKNSGPDFQNTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENNKNVASSKGTITLSVTSSKPETGEVIGVFQSLQPSDTDLGAKVPKDVKIEGVWYAQLEQ 331          
BLAST of CF834937 vs. ExPASy Swiss-Prot
Match: PSBO1_ARATH (Oxygen-evolving enhancer protein 1-1, chloroplastic OS=Arabidopsis thaliana GN=PSBO1 PE=1 SV=2)

HSP 1 Score: 342.043 bits (876), Expect = 1.887e-93
Identity = 163/193 (84.46%), Postives = 182/193 (94.30%), Query Frame = -3
Query:  148 PTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLAGGERVPFLFTIKQLVASGKPENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE 726
            PTSFTVKA+ V+KNAPP+FQNTKLMTRLTYTLDEIEGPFEV+ DG++ F E+DGIDYAAVTVQL GGERVPFLFT+KQL ASGKP++F G+FLVPSYRGSSFLDPKGRGGSTGYDNA+ALPAGGRGDEE+L KEN+KNT++S G+ITL VTKSKPETGEVIGVFES+QPSDTDLGAKVPKDVKIQG+WY QLE
Sbjct:  140 PTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDSFTGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKNTAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE 332          
BLAST of CF834937 vs. ExPASy Swiss-Prot
Match: PSBO_PEA (Oxygen-evolving enhancer protein 1, chloroplastic OS=Pisum sativum GN=PSBO PE=2 SV=1)

HSP 1 Score: 340.502 bits (872), Expect = 5.491e-93
Identity = 167/193 (86.53%), Postives = 179/193 (92.75%), Query Frame = -3
Query:  148 PTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLAGGERVPFLFTIKQLVASGKPENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE 726
            PTSFTVK+EGV KN P  FQNTKLMTRLTYTLDEIEGPFEVS DG++KF EKDGIDYAAVTVQL GGERVPFLFTIKQLVASGKP++F GEFLVPSYRGSSFLDPKGRG STGYDNA+ALPAGGRGDEE+L KEN K+ +SS GKITLSVT++KPETGEVIGVFESIQPSDTDLGAK PKDVKIQG+WYAQLE
Sbjct:  136 PTSFTVKSEGVTKNTPLAFQNTKLMTRLTYTLDEIEGPFEVSADGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFSGEFLVPSYRGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELGKENNKSAASSKGKITLSVTQTKPETGEVIGVFESIQPSDTDLGAKAPKDVKIQGVWYAQLE 328          
BLAST of CF834937 vs. ExPASy Swiss-Prot
Match: PSBO_WHEAT (Oxygen-evolving enhancer protein 1, chloroplastic OS=Triticum aestivum GN=PSBO PE=2 SV=1)

HSP 1 Score: 315.464 bits (807), Expect = 1.892e-85
Identity = 161/193 (83.42%), Postives = 171/193 (88.60%), Query Frame = -3
Query:  148 PTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLAGGERVPFLFTIKQLVASGKPENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE 726
            PTSFTVKAEG+ KN PP FQ TKLMTRLTYTLDE+EGP EV    T+KF EKDGIDYAAVTVQL GGERV FLFT+KQLVA+GKPE+F   FLVPSYRGSSFLDPKGRGGSTGYDNA ALP GGRGDEE+LAKEN+KN SSSTG ITLSVTKSKPETGEVIGVFES+QPSDTDL A  PKDVKIQG+WYAQLE
Sbjct:  134 PTSFTVKAEGIQKNEPPRFQKTKLMTRLTYTLDEMEGPLEVRRRRTLKFEEKDGIDYAAVTVQLPGGERVAFLFTVKQLVATGKPESFR-PFLVPSYRGSSFLDPKGRGGSTGYDNAGALPRGGRGDEEELAKENVKNASSSTGNITLSVTKSKPETGEVIGVFESVQPSDTDLEA--PKDVKIQGVWYAQLE 323          
BLAST of CF834937 vs. ExPASy Swiss-Prot
Match: PSBO_VOLCA (Oxygen-evolving enhancer protein 1, chloroplastic OS=Volvox carteri GN=PSBO PE=2 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 9.760e-66
Identity = 126/194 (64.95%), Postives = 143/194 (73.71%), Query Frame = -3
Query:  145 PTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLAGGERVPFLFTIKQLVASGKPENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLEQ 726
            PTSFTVK E V K    +F  TKLMTRLTYTLD + G  +V  DG+ +  E+DGIDYAA TVQL GGERV FLFTIKQ    G  +N  G+F+VPSYRGSSFLDPKGRGGSTGYDNA+ALPA  R D E+L KEN+K+T +  G    SV K    TGE+ GVFESIQPSDTDLGAK PKD+KI G+WY QL Q
Sbjct:  102 PTSFTVKEESVFKGGETEFVKTKLMTRLTYTLDAMSGTLKVGSDGSAELKEEDGIDYAATTVQLPGGERVAFLFTIKQFDGKGTLDNIKGDFVVPSYRGSSFLDPKGRGGSTGYDNAVALPA--RADAEELLKENVKSTKALKGSAVFSVAKVNTATGEIAGVFESIQPSDTDLGAKPPKDIKITGLWYGQLSQ 293          
The following BLAST results are available for this feature:
BLAST of CF834937 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 19
Match NameE-valueIdentityDescription
PSBO_TOBAC2.082e-10093.26Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO_SOLLC3.926e-9991.71Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO_FRIAG7.404e-9889.12Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO_SOLTU5.306e-9688.60Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO2_ARATH7.662e-9584.97Oxygen-evolving enhancer protein 1-2, chloroplasti... [more]
PSBO_SPIOL1.001e-9486.60Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO1_ARATH1.887e-9384.46Oxygen-evolving enhancer protein 1-1, chloroplasti... [more]
PSBO_PEA5.491e-9386.53Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO_WHEAT1.892e-8583.42Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO_VOLCA9.760e-6664.95Oxygen-evolving enhancer protein 1, chloroplastic ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_06G04_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa06G04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF834937 ID=CF834937|Name=CF834937|organism=Citrus sinensis|type=EST|length=728bp
CCCCTCAGTTTTTTTTTTTTTTTTATTACAGACGTGATAACATTCTCAGT
GCTACTACCTTGAATTACAGAAATGTTTAGCAACACCTTCAACATGTTTC
AAAATCTGAATAGGAATAAGTACACTCATACAAGAAAAGCTCTATTGCTC
AAGCTGTGCATACCAGATACCCTGGATCTTAACATCCTTTGGAACCTTGG
CTCCCAAATCAGTATCAGATGGCTGAATGCTCTCAAACACTCCAATAACC
TCTCCGGTCTCAGGCTTGCTCTTGGTAACGCTGAGGGTGATCTTCCCTGT
TGAAGATGAAGTATTCTTGATATTCTCCTTGGCGAGATCTTCCTCGTCCC
CTCTTCCACCGGCAGGCAATGCAATAGCATTGTCATAACCAGTTGAACCA
CCCCTTCCCTTTGGGTCCAAGAAGGATGATCCACGGTAAGATGGTACCAG
GAATTCTCCTCCGAAATTCTCAGGTTTGCCTGATGCTACCAATTGTTTGA
TGGTGAAAAGGAAGGGCACACGCTCGCCTCCAGCCAGCTGAACTGTCACA
GCAGCATAGTCAATTCCATCCTTCTCCACAAACTTAATGGTGCCATCGGG
GGACACTTCAAAAGGTCCCTCAATCTCGTCAAGGGTGTAGGTAAGGCGGG
TCATGAGCTTGGTGTTCTGGAAATCTGGTGGGGCATTCTTGTTGACACCC
TCAGCCTTGACAGTGAAGGAAGTTGGTT
back to top