CF834940

Overview
NameCF834940
Unique NameCF834940
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length514
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF834940 vs. ExPASy Swiss-Prot
Match: HAT4_ARATH (Homeobox-leucine zipper protein HAT4 OS=Arabidopsis thaliana GN=HAT4 PE=1 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 9.230e-17
Identity = 50/101 (49.50%), Postives = 55/101 (54.46%), Query Frame = -2
Query:  214 RCCENLTEENRRLQKEVQELRALKLSPQFYXXXXXXXXXXXXPSCERXXXXXXXXXXXXXXDRPTHQMDAPNHHRPIPISPWAPVAAIPHGPS-DAIRHRS 513
            RCCENLTEENRRLQKEV ELRALKLSPQFY            PSCE                 P  Q     HHR +P++ WAP   I HG + DA+R RS
Sbjct:  195 RCCENLTEENRRLQKEVTELRALKLSPQFYMHMSPPTTLTMCPSCEHVSVPP-----------PQPQAATSAHHRSLPVNAWAPATRISHGLTFDALRPRS 284          
BLAST of CF834940 vs. ExPASy Swiss-Prot
Match: HAT2_ARATH (Homeobox-leucine zipper protein HAT2 OS=Arabidopsis thaliana GN=HAT2 PE=2 SV=2)

HSP 1 Score: 67.3958 bits (163), Expect = 4.437e-11
Identity = 43/102 (42.16%), Postives = 52/102 (50.98%), Query Frame = -2
Query:  214 RCCENLTEENRRLQKEVQELRALKLSPQFYXXXXXXXXXXXXPSCERXXXXXXXXXXXXXXDRPTHQMDAPNHHRPIPISPWAPVAA-IPHGPS-DAIRHRS 513
            RC E LTEENRRLQKE  ELR LKLSPQFY            PSCER                     +  ++HRP+ I+PW   A  + HG + +A+R RS
Sbjct:  196 RCVEKLTEENRRLQKEAMELRTLKLSPQFYGQMTPPTTLIMCPSCERVGG--------------PSSSNHHHNHRPVSINPWVACAGQVAHGLNFEALRPRS 283          
The following BLAST results are available for this feature:
BLAST of CF834940 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
HAT4_ARATH9.230e-1749.50Homeobox-leucine zipper protein HAT4 OS=Arabidopsi... [more]
HAT2_ARATH4.437e-1142.16Homeobox-leucine zipper protein HAT2 OS=Arabidopsi... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_06G07_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa06G07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF834940 ID=CF834940|Name=CF834940|organism=Citrus sinensis|type=EST|length=514bp
TCAAAACAAAGGAACACCCTCCATATCATATTTACTACCCACCATATCTT
ATACCTAAGACTTTGAACAATAATCATCTCGCACGCAACAAACTACAAAT
GTAAGCCCCCATCCGTTCCGTACAACACACATCCCAACAGCCTTTACAAG
AAGAGCACCATTTTTATGCATTGAAAAAATGACCATAACGCCCTTGCATG
AGGAATACGATCACGATCGATGACGGATTGCATCAGAGGGTCCATGAGGG
ATGGCAGCAACGGGGGCCCAAGGGCTGATGGGGATGGGTCTGTGATGATT
GGGAGCATCCATCTGATGAGTAGGCCTATCCGGATCAACGGCTGATGCTG
CACCGGATGGTGGGACTGCCACACGCTCACACGAAGGACACATCGTAAGT
GTTGTGGGTGGGGTCATTTACATGTAGAACTGCGGGGAAAGCTTCAGTGC
TCTCAGCTCCTGAACTTCTTTCTGCAACCGCCTGTTCTCCTCCGTCAGAT
TCTCACAGCATCTC
back to top