CF834943

Overview
NameCF834943
Unique NameCF834943
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length243
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF834943 vs. ExPASy Swiss-Prot
Match: BAS1_ORYSJ (2-Cys peroxiredoxin BAS1, chloroplastic OS=Oryza sativa subsp. japonica GN=BAS1 PE=1 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 1.772e-28
Identity = 63/80 (78.75%), Postives = 70/80 (87.50%), Query Frame = 3
Query:    3 LGVSTDSVFSHLAWVQTNRKP*GLGDLKDPLIADITKSISKSYGILIPDHGIALKGLFISDK*GVVLHSAIINLAIGRSV 242
            LGVS DSVFSHLAWVQT+RK  GLGDLK PLI+D+TKSISKS+G+LIPD GIAL+GLFI DK GV+ HS I NLAIGRSV
Sbjct:  136 LGVSIDSVFSHLAWVQTDRKSGGLGDLKYPLISDVTKSISKSFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLAIGRSV 215          
BLAST of CF834943 vs. ExPASy Swiss-Prot
Match: BAS1_WHEAT (2-Cys peroxiredoxin BAS1, chloroplastic (Fragment) OS=Triticum aestivum GN=TSA PE=1 SV=2)

HSP 1 Score: 122.479 bits (306), Expect = 6.734e-28
Identity = 61/80 (76.25%), Postives = 68/80 (85.00%), Query Frame = 3
Query:    3 LGVSTDSVFSHLAWVQTNRKP*GLGDLKDPLIADITKSISKSYGILIPDHGIALKGLFISDK*GVVLHSAIINLAIGRSV 242
            LGVS DSVFSHLAWVQT RK  GLGDLK PL++D+TKSISKS+G+LIPD GIAL+GLFI DK GV+ HS I NL IGRSV
Sbjct:   86 LGVSVDSVFSHLAWVQTERKSGGLGDLKYPLVSDVTKSISKSFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLGIGRSV 165          
BLAST of CF834943 vs. ExPASy Swiss-Prot
Match: BAS1_HORVU (2-Cys peroxiredoxin BAS1, chloroplastic (Fragment) OS=Hordeum vulgare GN=BAS1 PE=2 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 6.734e-28
Identity = 61/80 (76.25%), Postives = 68/80 (85.00%), Query Frame = 3
Query:    3 LGVSTDSVFSHLAWVQTNRKP*GLGDLKDPLIADITKSISKSYGILIPDHGIALKGLFISDK*GVVLHSAIINLAIGRSV 242
            LGVS DSVFSHLAWVQT RK  GLGDLK PL++D+TKSISKS+G+LIPD GIAL+GLFI DK GV+ HS I NL IGRSV
Sbjct:   86 LGVSVDSVFSHLAWVQTERKSGGLGDLKYPLVSDVTKSISKSFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLGIGRSV 165          
BLAST of CF834943 vs. ExPASy Swiss-Prot
Match: BAS1B_ARATH (2-Cys peroxiredoxin BAS1-like, chloroplastic OS=Arabidopsis thaliana GN=At5g06290 PE=2 SV=2)

HSP 1 Score: 121.324 bits (303), Expect = 1.500e-27
Identity = 61/80 (76.25%), Postives = 68/80 (85.00%), Query Frame = 3
Query:    3 LGVSTDSVFSHLAWVQTNRKP*GLGDLKDPLIADITKSISKSYGILIPDHGIALKGLFISDK*GVVLHSAIINLAIGRSV 242
            LGVS DSVFSHLAWVQT+RK  GLGDL  PL++DITKSISKS+G+LIPD GIAL+GLFI DK GV+ HS I NL IGRSV
Sbjct:  146 LGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLVSDITKSISKSFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLGIGRSV 225          
BLAST of CF834943 vs. ExPASy Swiss-Prot
Match: BAS1_SPIOL (2-Cys peroxiredoxin BAS1, chloroplastic OS=Spinacia oleracea GN=BAS1 PE=2 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 1.659e-26
Identity = 60/80 (75.00%), Postives = 67/80 (83.75%), Query Frame = 3
Query:    3 LGVSTDSVFSHLAWVQTNRKP*GLGDLKDPLIADITKSISKSYGILIPDHGIALKGLFISDK*GVVLHSAIINLAIGRSV 242
            LGVS DSVFSHLAWVQT+RK  GLGDL  PLI+D+TKSISKS+G+LI D GIAL+GLFI DK GV+ HS I NL IGRSV
Sbjct:  141 LGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSV 220          
BLAST of CF834943 vs. ExPASy Swiss-Prot
Match: BAS1A_ARATH (2-Cys peroxiredoxin BAS1, chloroplastic OS=Arabidopsis thaliana GN=BAS1 PE=1 SV=2)

HSP 1 Score: 117.857 bits (294), Expect = 1.659e-26
Identity = 60/80 (75.00%), Postives = 67/80 (83.75%), Query Frame = 3
Query:    3 LGVSTDSVFSHLAWVQTNRKP*GLGDLKDPLIADITKSISKSYGILIPDHGIALKGLFISDK*GVVLHSAIINLAIGRSV 242
            LGVS DSVFSHLAWVQT+RK  GLGDL  PLI+D+TKSISKS+G+LI D GIAL+GLFI DK GV+ HS I NL IGRSV
Sbjct:  141 LGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSV 220          
BLAST of CF834943 vs. ExPASy Swiss-Prot
Match: Y755_SYNY3 (Putative peroxiredoxin sll0755 OS=Synechocystis sp. (strain PCC 6803) GN=sll0755 PE=3 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 2.565e-19
Identity = 42/80 (52.50%), Postives = 62/80 (77.50%), Query Frame = 3
Query:    3 LGVSTDSVFSHLAWVQTNRKP*GLGDLKDPLIADITKSISKSYGILIPDHGIALKGLFISDK*GVVLHSAIINLAIGRSV 242
            +G+S DS FSHLAW+QT RK  G+G++  PL++D+ K IS++Y +L PD GIAL+GLFI D+ G++ ++ + NL+ GRSV
Sbjct:   72 VGISVDSEFSHLAWIQTERKMGGIGNINYPLVSDLKKEISQAYNVLEPDAGIALRGLFIIDREGILQYATVNNLSFGRSV 151          
BLAST of CF834943 vs. ExPASy Swiss-Prot
Match: PRDX2_RAT (Peroxiredoxin-2 OS=Rattus norvegicus GN=Prdx2 PE=1 SV=3)

HSP 1 Score: 90.5077 bits (223), Expect = 2.836e-18
Identity = 45/80 (56.25%), Postives = 58/80 (72.50%), Query Frame = 3
Query:    3 LGVSTDSVFSHLAWVQTNRKP*GLGDLKDPLIADITKSISKSYGILIPDHGIALKGLFISDK*GVVLHSAIINLAIGRSV 242
            LGVS DS F+HLAW+ T RK  GLG L  PL+AD+TKS+S++YG+L  D GIA +GLFI D  GV+    + +L +GRSV
Sbjct:   73 LGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQITVNDLPVGRSV 152          
BLAST of CF834943 vs. ExPASy Swiss-Prot
Match: PRDX2_MOUSE (Peroxiredoxin-2 OS=Mus musculus GN=Prdx2 PE=1 SV=3)

HSP 1 Score: 90.5077 bits (223), Expect = 2.836e-18
Identity = 45/80 (56.25%), Postives = 58/80 (72.50%), Query Frame = 3
Query:    3 LGVSTDSVFSHLAWVQTNRKP*GLGDLKDPLIADITKSISKSYGILIPDHGIALKGLFISDK*GVVLHSAIINLAIGRSV 242
            LGVS DS F+HLAW+ T RK  GLG L  PL+AD+TKS+S++YG+L  D GIA +GLFI D  GV+    + +L +GRSV
Sbjct:   73 LGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQITVNDLPVGRSV 152          
BLAST of CF834943 vs. ExPASy Swiss-Prot
Match: PRDX2_CRIGR (Peroxiredoxin-2 OS=Cricetulus griseus GN=PRDX2 PE=2 SV=3)

HSP 1 Score: 89.3521 bits (220), Expect = 6.318e-18
Identity = 43/80 (53.75%), Postives = 58/80 (72.50%), Query Frame = 3
Query:    3 LGVSTDSVFSHLAWVQTNRKP*GLGDLKDPLIADITKSISKSYGILIPDHGIALKGLFISDK*GVVLHSAIINLAIGRSV 242
            LGVS DS F+HLAW+ T RK  GLG L  PL+AD+T+S+S++YG+L  D GIA +GLFI D  G++    + +L +GRSV
Sbjct:   73 LGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRSLSENYGVLKTDEGIAYRGLFIIDAKGILRQITVNDLPVGRSV 152          
The following BLAST results are available for this feature:
BLAST of CF834943 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 51
Match NameE-valueIdentityDescription
BAS1_ORYSJ1.772e-2878.752-Cys peroxiredoxin BAS1, chloroplastic OS=Oryza s... [more]
BAS1_WHEAT6.734e-2876.252-Cys peroxiredoxin BAS1, chloroplastic (Fragment)... [more]
BAS1_HORVU6.734e-2876.252-Cys peroxiredoxin BAS1, chloroplastic (Fragment)... [more]
BAS1B_ARATH1.500e-2776.252-Cys peroxiredoxin BAS1-like, chloroplastic OS=Ar... [more]
BAS1_SPIOL1.659e-2675.002-Cys peroxiredoxin BAS1, chloroplastic OS=Spinaci... [more]
BAS1A_ARATH1.659e-2675.002-Cys peroxiredoxin BAS1, chloroplastic OS=Arabido... [more]
Y755_SYNY32.565e-1952.50Putative peroxiredoxin sll0755 OS=Synechocystis sp... [more]
PRDX2_RAT2.836e-1856.25Peroxiredoxin-2 OS=Rattus norvegicus GN=Prdx2 PE=1... [more]
PRDX2_MOUSE2.836e-1856.25Peroxiredoxin-2 OS=Mus musculus GN=Prdx2 PE=1 SV=3[more]
PRDX2_CRIGR6.318e-1853.75Peroxiredoxin-2 OS=Cricetulus griseus GN=PRDX2 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_06G09_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa06G09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF834943 ID=CF834943|Name=CF834943|organism=Citrus sinensis|type=EST|length=243bp
TATTGGGGGTCTCCACTGACAGTGTGTTTTCGCACTTGGCATGGGTCCAA
ACGAACAGAAAGCCATGAGGTCTTGGTGATTTGAAGGACCCACTAATTGC
TGATATCACCAAATCAATTTCAAAATCCTATGGTATTCTGATCCCTGATC
ACGGAATTGCATTGAAAGGACTCTTTATTAGTGACAAATAAGGAGTCGTC
CTTCACTCAGCCATTATCAACCTTGCCATTGGTAGGAGTGTTG
back to top