CF835203

Overview
NameCF835203
Unique NameCF835203
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length597
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF835203 vs. ExPASy Swiss-Prot
Match: RFS2_ARATH (Probable galactinol--sucrose galactosyltransferase 2 OS=Arabidopsis thaliana GN=RFS2 PE=2 SV=2)

HSP 1 Score: 151.754 bits (382), Expect = 2.490e-36
Identity = 74/116 (63.79%), Postives = 91/116 (78.45%), Query Frame = 2
Query:    5 NISFAAIGLLDMFNSGRAVENVDVR-MAEKKPELFDGEVSSELTSSLSDNRSPAAAISLKVRGCGRFGIYSSQRPLKCTVGSIQTDFTYDSATGLMTMTLPVPEEEMYRWPVEIQV 349
            NISFA IGL+DMFNS  A+E++D+  + +K PE FDGE+SS  + +LSDNRSP A +S+ VRGCGRFG YSSQRPLKC V S +TDFTYD+  GL+T+ LPV  EEM+RW VEI V
Sbjct:  659 NISFAPIGLVDMFNSSGAIESIDINHVTDKNPEFFDGEISSA-SPALSDNRSPTALVSVSVRGCGRFGAYSSQRPLKCAVESTETDFTYDAEVGLVTLNLPVTREEMFRWHVEILV 773          
BLAST of CF835203 vs. ExPASy Swiss-Prot
Match: RFS1_ARATH (Probable galactinol--sucrose galactosyltransferase 1 OS=Arabidopsis thaliana GN=RFS1 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 4.728e-11
Identity = 40/112 (35.71%), Postives = 57/112 (50.89%), Query Frame = 2
Query:   14 FAAIGLLDMFNSGRAVENVDVRMAEKKPELFDGEVSSELTSSLSDNRSPAAAISLKVRGCGRFGIYSS-QRPLKCTVGSIQTDFTYDSATGLMTMTLPVPEEEMYRWPVEIQ 346
            FA +GL++MFNSG A+                        S   D+      + +K+RG G  G+YSS +RP   TV S   ++ Y+  +GL+T TL VPE+E+Y W V IQ
Sbjct:  666 FAPVGLMEMFNSGGAI-----------------------VSLRYDDEGTKFVVRMKLRGSGLVGVYSSVRRPRSVTVDSDDVEYRYEPESGLVTFTLGVPEKELYLWDVVIQ 754          
The following BLAST results are available for this feature:
BLAST of CF835203 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
RFS2_ARATH2.490e-3663.79Probable galactinol--sucrose galactosyltransferase... [more]
RFS1_ARATH4.728e-1135.71Probable galactinol--sucrose galactosyltransferase... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_06N11_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa06N11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835203 ID=CF835203; Name=CF835203; organism=Citrus sinensis; type=EST; length=597bp
TTCAAACATTTCCTTTGCAGCAATAGGCTTGCTCGACATGTTCAACAGTG
GACGTGCTGTCGAGAATGTGGATGTGCGTATGGCTGAGAAGAAGCCAGAG
CTCTTTGATGGCGAAGTATCTTCCGAACTGACCTCCTCCCTCAGTGACAA
CCGATCTCCAGCCGCCGCAATCTCTCTCAAAGTTAGGGGATGTGGAAGGT
TTGGCATTTACTCTTCCCAGCGTCCTCTGAAATGCACCGTGGGCAGCATC
CAGACCGACTTCACCTACGATTCTGCAACCGGCTTGATGACCATGACACT
CCCGGTTCCGGAGGAAGAGATGTACAGATGGCCTGTTGAGATCCAAGTCT
AAGGACTTTCATGTTATGTTATTAAATAACATCGGATTGTTAGATTTGTC
ACCATGTTCAGGGGGGGTTTCCATTCAAGTGGGAAGCTGTGGTGAAACAT
GACTTGCATTTGAGTGATGATCATGAAAAGAATAACTGCTAGAATTATGT
TGCTGTTTGGTTCTCTGTAATAAAAGTGGTCTTATCTTCTGATCATCGAA
TTTTCAAATCTTTTTCTTGATCTTTACAAACAAAAAAAAAAAAAAAA
back to top