CF835324

Overview
NameCF835324
Unique NameCF835324
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length860
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8097 contig Csv1_Contig8097:12..871. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835324 vs. ExPASy Swiss-Prot
Match: CB12_PETHY (Chlorophyll a-b binding protein, chloroplastic OS=Petunia hybrida PE=2 SV=1)

HSP 1 Score: 436.417 bits (1121), Expect = 9.683e-122
Identity = 199/239 (83.26%), Postives = 215/239 (89.96%), Query Frame = 1
Query:  142 QKSRSVAGATKASFXXXXXXXXXXXXATAGTRSVSVSAAAADPNRPLWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPELLTKLGILNTPSWYTAGELEYFTDTTTLFIVEMIFIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKVKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLIAHLADPG 858
            QK+ S+ GATKASF            A  G+RSV+VSA AADP+RPLWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPE+L+WN Q+E+VH RWAMLGAAGIFIPE LTK+G+LNTPSWYTAGE EYFTDTTTLF++E++ IGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSP K+KELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNL AHLADPG
Sbjct:   21 QKNGSIVGATKASFLGGKRLRVSKFIAPVGSRSVAVSAVAADPDRPLWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPESLKWNAQAELVHSRWAMLGAAGIFIPEFLTKIGVLNTPSWYTAGEQEYFTDTTTLFVIELVLIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPAKIKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPG 259          
BLAST of CF835324 vs. ExPASy Swiss-Prot
Match: CB12_SOLLC (Chlorophyll a-b binding protein 7, chloroplastic OS=Solanum lycopersicum GN=CAB7 PE=3 SV=1)

HSP 1 Score: 424.476 bits (1090), Expect = 3.808e-118
Identity = 195/239 (81.59%), Postives = 208/239 (87.03%), Query Frame = 1
Query:  142 QKSRSVAGATKASFXXXXXXXXXXXXATAGTRSVSVSAAAADPNRPLWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPELLTKLGILNTPSWYTAGELEYFTDTTTLFIVEMIFIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKVKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLIAHLADPG 858
            +++ S+ G TKASF             T   RS +    AADP+RPLWFPGSTPP WLDGSLPGDFGFDPLGL SDPE+LRWN Q+E+VHCRWAMLGAAGIFIPELLTK+GILNTPSWYTAGE EYFTDTTTLFIVE++ IGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSP K+KELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNL AHLADPG
Sbjct:   21 RRNGSIVGTTKASFLGGRRLRVSKYSTTPTARSATTVCVAADPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLASDPESLRWNQQAELVHCRWAMLGAAGIFIPELLTKIGILNTPSWYTAGEQEYFTDTTTLFIVELVLIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPAKIKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPG 259          
BLAST of CF835324 vs. ExPASy Swiss-Prot
Match: CB24_PEA (Chlorophyll a-b binding protein P4, chloroplastic OS=Pisum sativum GN=lhcA-P4 PE=1 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 1.575e-55
Identity = 104/191 (54.45%), Postives = 128/191 (67.02%), Query Frame = 1
Query:  283 WFPGSTPPEWLDGSLPGDFGFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPELLTKLGILNTPSWYTAGELEYFTDTTTLFIVEMIFIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKVKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLIAHLADP 855
            W PG   P +L GSLPGD GFDPLGL  DPE LRW VQ+E+V+ RWAMLG AG+ +PE+ T +GI+N P WY AG+ EYF  ++TLF++E I   + E RRW DI  PG VN DPIF    L   +VGYPGG+ F+PL +         E + KEI NGRLAMLA +G   QH  TG GP DNL+ H++DP
Sbjct:   56 WLPGLASPGYLTGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTSIGIINVPKWYAAGKEEYFASSSTLFVIEFILSHYVEIRRWQDIKNPGSVNQDPIFKQYSLPAGEVGYPGGI-FNPLNFA-----PTLEAKEKEIANGRLAMLAFLGFIIQHNVTGKGPFDNLLQHISDP 240          
BLAST of CF835324 vs. ExPASy Swiss-Prot
Match: CB24_ARATH (Chlorophyll a-b binding protein 4, chloroplastic OS=Arabidopsis thaliana GN=CAB4 PE=1 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 4.582e-55
Identity = 103/206 (50.00%), Postives = 135/206 (65.53%), Query Frame = 1
Query:  238 SVSVSAAAADPNRPLWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPELLTKLGILNTPSWYTAGELEYFTDTTTLFIVEMIFIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKVKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLIAHLADP 855
            S   S+   +  +  W PG   P++L GSL GD GFDPLGL  DPE L+W VQ+E+V+ RWAMLG AG+ +PE+ TK+GI+N P WY AG+ +YF  ++TLF++E I   + E RRW DI  PG VN DPIF    L   +VGYPGG+ F+PL +        +E + KE+ NGRLAMLA +G   QH  TG GP +NL+ HL+DP
Sbjct:   42 SAKTSSFKVEAKKGEWLPGLASPDYLTGSLAGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVFTKIGIINVPEWYDAGKEQYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPKGEVGYPGGI-FNPLNFA-----PTQEAKEKELANGRLAMLAFLGFVVQHNVTGKGPFENLLQHLSDP 241          
BLAST of CF835324 vs. ExPASy Swiss-Prot
Match: CB120_HORVU (Chlorophyll a-b binding protein 1B-20, chloroplastic (Fragment) OS=Hordeum vulgare GN=LHC Ib-20 PE=1 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 2.786e-44
Identity = 102/208 (49.04%), Postives = 127/208 (61.06%), Query Frame = 1
Query:  235 RSVSVSAAAADPNRPLWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPELLTKLGILNTPSWY-TAGELEYFTDTTTLFIVEMIFIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKVKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLIAHLADP 855
            R V+V A  +      W PG   P +LDGSL GD GFDPL L  DPE LRW VQ+++V+ RWAMLG AG+ IPE+LTK G++N P W    G+  YF  ++T   V M    + E RRW DI  PG VN DPIF +  L   + GYPG + F+PL +   +P + KE   KE+ NGRLAMLA +G   QH   G GP +NL  HLADP
Sbjct:   26 RDVAVQAKGS------WLPGLQSPAYLDGSLEGDNGFDPLALAEDPEDLRWFVQADVVNGRWAMLGVAGMLIPEVLTKAGLMNAPEWLRLPGKETYFASSSTALRVHMSST-YVEIRRWQDIKNPGSVNQDPIFKSYSLPPHECGYPGRV-FNPLNF---APLENKE---KELANGRLAMLAFLGFLVQHNVHGKGPFENLQQHLADP 219          
BLAST of CF835324 vs. ExPASy Swiss-Prot
Match: CB13_SOLLC (Chlorophyll a-b binding protein 8, chloroplastic OS=Solanum lycopersicum GN=CAB8 PE=3 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 1.997e-42
Identity = 100/224 (44.64%), Postives = 129/224 (57.59%), Query Frame = 1
Query:  235 RSVSVSAAAADPNRPLWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPETL------RWNVQSEIVHCRWAMLGAAGIFIPELLTKLGIL---NTPSWYT------AGELEYFTDTTTLFIVEMIFIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGT--DVGYPGGLWFDPLGWGSGSPEKVKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLIAHLADP 855
            R+ S        NR LWF       +LDG LPGDFGFDPLGL SDPE        +W    E+++ R+AMLGAAG   PE+L K G++      +W+       AG   Y+ D  TLF++EM  +G+AE RR+ D  KPG +         K  G   D  YPGG  F+PLG+G    + +KEL+ KEIKNGRLAMLA++G + Q + TG GP  NL+ HLADP
Sbjct:   40 RAASTPPVKQGANRQLWFASKQSLSYLDGRLPGDFGFDPLGL-SDPEGTGGFIEPKWLAYGEVINGRFAMLGAAGAIAPEILGKAGLIPQETALAWFQTGVIPPAGTYNYWADNYTLFVLEMALMGFAEHRRFQDWAKPGSMGKQYFLGLEKGLGGSGDPAYPGGPLFNPLGFGKDE-KSMKELKLKEIKNGRLAMLAILGYFIQALVTGVGPYQNLLDHLADP 261          
BLAST of CF835324 vs. ExPASy Swiss-Prot
Match: CB23_PEA (Chlorophyll a-b binding protein 3, chloroplastic OS=Pisum sativum GN=lhca3 PE=1 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 4.448e-42
Identity = 101/231 (43.72%), Postives = 135/231 (58.44%), Query Frame = 1
Query:  232 TRSVSVSAAAADP------NRPLWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPETL------RWNVQSEIVHCRWAMLGAAGIFIPELLTKLGIL---NTPSWYT------AGELEYFTDTTTLFIVEMIFIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGT--DVGYPGGLWFDPLGWGSGSPEKVKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLIAHLADP 855
            +R   V AAA  P      +RPLWF       +LDGSLPGD+GFDPLGL SDPE        RW    E+++ R+AMLGA G   PE L K+G++      +W+       AG   Y+ D  TLF++EM  +G+AE RR+ D  KPG +         K  G   +  YPGG +F+PLG+G    + +KEL+ KE+KNGRLAMLA++G + Q + TG GP  NL+ H+ADP
Sbjct:   35 SRKGLVRAAATPPVKQGGVDRPLWFASKQSLSYLDGSLPGDYGFDPLGL-SDPEGTGGFIEPRWLAYGEVINGRFAMLGAVGAIAPEYLGKVGLIPQETALAWFQTGVIPPAGTYNYWADNYTLFVLEMALMGFAEHRRFQDWAKPGSMGKQYFLGLEKGFGGSGNPAYPGGPFFNPLGFGKDE-KSLKELKLKEVKNGRLAMLAILGYFIQGLVTGVGPYQNLLDHVADP 263          
BLAST of CF835324 vs. ExPASy Swiss-Prot
Match: CB2B_PINSY (Chlorophyll a-b binding protein type 2 member 1B, chloroplastic OS=Pinus sylvestris PE=2 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 1.434e-32
Identity = 92/224 (41.07%), Postives = 121/224 (54.02%), Query Frame = 1
Query:  226 AGTRSVSVSAAAAD---PNRPLW---FPGSTPPEWLDGSLPGDFGFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPELLTKLGI-LNTPSWYTAGE-------LEYFTDTTTLFIVEMIFIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKVKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLIAHLADP 855
            A T+ ++ SA+ +    P+R L+   F G  PP +L G  PGD+G+D  GL +DPE    N + E++HCRWAMLGA G   PELL + G+      W+ AG        L+Y  + + +    ++ I WA       +I  G V    I        TD  YPGG  FDPLG     PE   EL+ KEIKNGRLAM ++ G + Q I TG GPI+NL  HLADP
Sbjct:   44 ATTKKLTASASTSPWYGPDRVLYLGPFSGE-PPSYLTGEFPGDYGWDTAGLSADPENFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAI-WA-----CQVILMGAVEGYRIAGGPLGEVTDPIYPGGS-FDPLGLAE-DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADP 258          
BLAST of CF835324 vs. ExPASy Swiss-Prot
Match: CB121_HORVU (Chlorophyll a-b binding protein 1B-21, chloroplastic OS=Hordeum vulgare GN=LHC Ib-21 PE=1 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 1.873e-32
Identity = 87/200 (43.50%), Postives = 107/200 (53.50%), Query Frame = 1
Query:  283 WFPGSTPPEWLDGSLPGDFGFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPELLTKLGILNTPSWYTA--GELEY------FTDTTTLFIVEMIFIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKVKELRTKEIKNGRLAMLAVMGAWFQH-IYTGTGPIDNLIAHLADP 855
            WFPG   P  LDGS PGDFGFDPLGL + PE      +SEI HCRWAML   G+ +PE L     +    W     G+  Y      + +  T+  +E + I +AE +R         +  DP             YPGG  FDPLG+ S  P K +EL+ KEIKNGRLAMLA +G   Q   Y GTGP++NL  HLADP
Sbjct:   48 WFPGQPRPAHLDGSSPGDFGFDPLGLATVPENFERFKESEIYHCRWAMLCVPGVLVPEALGLGNWVKAQEWAALPDGQATYLGNPVPWGNLPTILAIEFLAIAFAEQQR--------TMEKDP---------EKKKYPGGA-FDPLGF-SKDPAKFEELKLKEIKNGRLAMLAFVGFCVQQSAYPGTGPLENLATHLADP 228          
BLAST of CF835324 vs. ExPASy Swiss-Prot
Match: CB11_SOLLC (Chlorophyll a-b binding protein 6A, chloroplastic OS=Solanum lycopersicum GN=CAB6A PE=2 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 4.173e-32
Identity = 82/200 (41.00%), Postives = 104/200 (52.00%), Query Frame = 1
Query:  283 WFPGSTPPEWLDGSLPGDFGFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPELLTKLGILNTPSW--YTAGELEYFTDTT------TLFIVEMIFIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKVKELRTKEIKNGRLAMLAVMGAWFQH-IYTGTGPIDNLIAHLADP 855
            W PG   P +LDGS PGDFGFD LGLG  P  L    +SE++HCRWAML   GI +PE L     +    W     G+  Y           T+  +E + I + E +R                 + +       YPGG  FDPLG+ S  P K +EL+ KEIKNGRLA+LA++G   Q   Y GTGP++NL  HLADP
Sbjct:   49 WMPGQPRPSYLDGSAPGDFGFDSLGLGEVPANLERYKESELIHCRWAMLAVPGIIVPEALGLGNWVKAQEWAAIPGGQATYLGQPVPWGTLPTILAIEFLAIAFVEHQR-----------------SMEKDSEKKKYPGGA-FDPLGY-SKDPAKFEELKVKEIKNGRLALLAIVGFCVQQSAYLGTGPLENLATHLADP 229          
The following BLAST results are available for this feature:
BLAST of CF835324 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 83
Match NameE-valueIdentityDescription
CB12_PETHY9.683e-12283.26Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB12_SOLLC3.808e-11881.59Chlorophyll a-b binding protein 7, chloroplastic O... [more]
CB24_PEA1.575e-5554.45Chlorophyll a-b binding protein P4, chloroplastic ... [more]
CB24_ARATH4.582e-5550.00Chlorophyll a-b binding protein 4, chloroplastic O... [more]
CB120_HORVU2.786e-4449.04Chlorophyll a-b binding protein 1B-20, chloroplast... [more]
CB13_SOLLC1.997e-4244.64Chlorophyll a-b binding protein 8, chloroplastic O... [more]
CB23_PEA4.448e-4243.72Chlorophyll a-b binding protein 3, chloroplastic O... [more]
CB2B_PINSY1.434e-3241.07Chlorophyll a-b binding protein type 2 member 1B, ... [more]
CB121_HORVU1.873e-3243.50Chlorophyll a-b binding protein 1B-21, chloroplast... [more]
CB11_SOLLC4.173e-3241.00Chlorophyll a-b binding protein 6A, chloroplastic ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01A19_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01A19, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835324 ID=CF835324|Name=CF835324|organism=Citrus sinensis|type=EST|length=860bp
CTTCTGTTCACTGCCTATTGTATTCTACTTTACACGCACACAAACGCCAG
TCATAATTTTGCTGAAAGCCTTTGCCTGGTAGTAAAAATGGCTTCCGTTT
GTGCTTCCCCTGCCGTTGCAGCCATCTCATCCCCCAGTTCTCAGAAGAGT
AGATCAGTTGCGGGAGCAACAAAGGCTTCTTTCCTTGGTGGGAAGAAGCT
GAAATTGAGAAAAAACGGAGCAACAGCGGGAACACGATCGGTTTCAGTGA
GTGCGGCTGCAGCTGATCCTAACAGGCCTCTCTGGTTCCCAGGCAGCACT
CCTCCTGAATGGCTCGATGGTAGCCTCCCCGGAGACTTCGGCTTCGATCC
TCTTGGTCTTGGATCTGATCCTGAGACGCTGAGATGGAACGTGCAATCAG
AAATTGTGCACTGCAGATGGGCAATGTTAGGAGCTGCAGGAATTTTCATT
CCGGAATTGTTAACAAAACTTGGAATCCTCAACACTCCATCCTGGTACAC
AGCTGGGGAGCTAGAGTACTTCACAGACACCACCACCCTGTTCATTGTTG
AGATGATATTCATAGGCTGGGCAGAGGGCAGACGGTGGGCCGACATTATA
AAGCCAGGCTGTGTGAACACTGACCCGATCTTCCCCAACAACAAGCTCAC
CGGCACCGATGTTGGGTACCCAGGTGGGCTTTGGTTTGACCCACTTGGCT
GGGGATCCGGTTCGCCCGAGAAGGTAAAGGAGCTGAGGACTAAGGAGATC
AAGAATGGAAGATTGGCTATGTTGGCTGTGATGGGTGCTTGGTTCCAGCA
CATTTACACCGGCACCGGCCCCATTGACAATCTCATTGCTCACCTTGCTG
ATCCTGGTCA
back to top