CF835330

Overview
NameCF835330
Unique NameCF835330
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length712
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig11659 contig Csv1_Contig11659:32..743. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835330 vs. ExPASy Swiss-Prot
Match: F10AL_ARATH (FAM10 family protein At4g22670 OS=Arabidopsis thaliana GN=At4g22670 PE=1 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 1.160e-23
Identity = 52/59 (88.14%), Postives = 56/59 (94.92%), Query Frame = -2
Query:  331 VDFSKILNDPELMAAFSDPEVMAALQDVMKNPANLAQHQANPKVAPIIAKMMAKFGGPK 507
            +DFSKILNDPELM AFSDPEVMAALQDVMKNPANLA+HQANPKVAP+IAKMM KF GP+
Sbjct:  383 MDFSKILNDPELMTAFSDPEVMAALQDVMKNPANLAKHQANPKVAPVIAKMMGKFAGPQ 441          
BLAST of CF835330 vs. ExPASy Swiss-Prot
Match: F10A1_PONAB (Hsc70-interacting protein OS=Pongo abelii GN=ST13 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 9.211e-13
Identity = 32/54 (59.26%), Postives = 46/54 (85.19%), Query Frame = -2
Query:  337 SKILNDPELMAAFSDPEVMAALQDVMKNPANLAQHQANPKVAPIIAKMMAKFGG 498
            ++IL+DPE++AA  DPEVM A QDV +NPAN++++Q+NPKV  +I+K+ AKFGG
Sbjct:  314 NEILSDPEVLAAMQDPEVMVAFQDVAQNPANMSKYQSNPKVMNLISKLSAKFGG 367          
BLAST of CF835330 vs. ExPASy Swiss-Prot
Match: F10A1_HUMAN (Hsc70-interacting protein OS=Homo sapiens GN=ST13 PE=1 SV=2)

HSP 1 Score: 73.9442 bits (180), Expect = 9.211e-13
Identity = 32/54 (59.26%), Postives = 46/54 (85.19%), Query Frame = -2
Query:  337 SKILNDPELMAAFSDPEVMAALQDVMKNPANLAQHQANPKVAPIIAKMMAKFGG 498
            ++IL+DPE++AA  DPEVM A QDV +NPAN++++Q+NPKV  +I+K+ AKFGG
Sbjct:  314 NEILSDPEVLAAMQDPEVMVAFQDVAQNPANMSKYQSNPKVMNLISKLSAKFGG 367          
BLAST of CF835330 vs. ExPASy Swiss-Prot
Match: F10A5_HUMAN (Protein FAM10A5 OS=Homo sapiens GN=FAM10A5 PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.571e-12
Identity = 32/54 (59.26%), Postives = 45/54 (83.33%), Query Frame = -2
Query:  337 SKILNDPELMAAFSDPEVMAALQDVMKNPANLAQHQANPKVAPIIAKMMAKFGG 498
            ++IL+DPE +AA  DPEVM A QDV +NPAN++++Q+NPKV  +I+K+ AKFGG
Sbjct:  314 NEILSDPEALAAMQDPEVMVAFQDVAQNPANMSKYQSNPKVMNLISKLSAKFGG 367          
BLAST of CF835330 vs. ExPASy Swiss-Prot
Match: F10A1_MOUSE (Hsc70-interacting protein OS=Mus musculus GN=St13 PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.052e-12
Identity = 31/54 (57.41%), Postives = 46/54 (85.19%), Query Frame = -2
Query:  337 SKILNDPELMAAFSDPEVMAALQDVMKNPANLAQHQANPKVAPIIAKMMAKFGG 498
            ++IL+DPE++AA  DPEVM A QDV +NP+N++++Q+NPKV  +I+K+ AKFGG
Sbjct:  316 NEILSDPEVLAAMQDPEVMVAFQDVAQNPSNMSKYQSNPKVMNLISKLSAKFGG 369          
BLAST of CF835330 vs. ExPASy Swiss-Prot
Match: F10A1_CHICK (Hsc70-interacting protein OS=Gallus gallus GN=ST13 PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 3.500e-12
Identity = 32/53 (60.38%), Postives = 44/53 (83.02%), Query Frame = -2
Query:  340 SKILNDPELMAAFSDPEVMAALQDVMKNPANLAQHQANPKVAPIIAKMMAKFG 498
            ++IL+DPE++AA  DPEVMAA QDV +NPAN++++Q NPKV  +I K+ AKFG
Sbjct:  306 NEILSDPEVLAAMQDPEVMAAFQDVAQNPANMSKYQNNPKVMSLITKLSAKFG 358          
BLAST of CF835330 vs. ExPASy Swiss-Prot
Match: F10A1_RAT (Hsc70-interacting protein OS=Rattus norvegicus GN=St13 PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 4.571e-12
Identity = 31/54 (57.41%), Postives = 45/54 (83.33%), Query Frame = -2
Query:  337 SKILNDPELMAAFSDPEVMAALQDVMKNPANLAQHQANPKVAPIIAKMMAKFGG 498
            ++IL+DPE++AA  DPEVM A QDV +NP+N++++Q NPKV  +I+K+ AKFGG
Sbjct:  313 NEILSDPEVLAAMQDPEVMVAFQDVAQNPSNMSKYQNNPKVMNLISKLSAKFGG 366          
The following BLAST results are available for this feature:
BLAST of CF835330 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
F10AL_ARATH1.160e-2388.14FAM10 family protein At4g22670 OS=Arabidopsis thal... [more]
F10A1_PONAB9.211e-1359.26Hsc70-interacting protein OS=Pongo abelii GN=ST13 ... [more]
F10A1_HUMAN9.211e-1359.26Hsc70-interacting protein OS=Homo sapiens GN=ST13 ... [more]
F10A5_HUMAN1.571e-1259.26Protein FAM10A5 OS=Homo sapiens GN=FAM10A5 PE=1 SV... [more]
F10A1_MOUSE2.052e-1257.41Hsc70-interacting protein OS=Mus musculus GN=St13 ... [more]
F10A1_CHICK3.500e-1260.38Hsc70-interacting protein OS=Gallus gallus GN=ST13... [more]
F10A1_RAT4.571e-1257.41Hsc70-interacting protein OS=Rattus norvegicus GN=... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01A23_f Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01A23, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835330 ID=CF835330|Name=CF835330|organism=Citrus sinensis|type=EST|length=712bp
TTTTTTTTTTTTTTTTTAACCAAAAATTATAGGCTATGGCCCCTTTAAAA
TAATNCTGCAAGTAAAAACTAGTCCCAAGTCCTGAAAGCACATTCTTTGT
TCAGCAACTAAGACAAGAATTTGAGGACGAAATTTTAAACCACTACATAA
ACTCAATCCTTTCACCCAGAAAGAAAAATTCCCAGCAGATATGTAGATGC
AGCTGCCAAACATTCCTAATCCATACCATACCCAGAAATCGTAAGAGCCG
CACAAGATTCATGAGATGTGACACACAAAGGTTACCATTCACCAACAACA
AAATAAGATGCCAGCCCGGAAAGCAATCTACTTGGGTCCTCCAAACTTGG
CCATCATCTTAGCAATTATGGGAGCCACTTTGGGATTTGCTTGATGCTGA
GCGAGATTAGCAGGGTTCTTCATTACATCTTGAAGAGCAGCCATGACTTC
TGGATCGCTAAATGCTGCCATCAACTCAGGGTCATTTAATATCTTGCTAA
AATCAACATTTCCAGGCCCCCCTCCTGGCATGCCACCCGGGAAGCCTCCT
GGCATGCCACCTGGGAAGCCTCCTGGCATGCCACCTGGGAAGCCTCCTGG
CATGCCACCAGGGAAGCCTCCAGGCATGCCTCCAGGGAAGCCTCCTGGCA
TTCCACCTGCTCCACCAGGAATCCCTCCAGGTCTTTCGCTTGAAGATGAT
TGCTCTTCCTTC
back to top