CF835332

Overview
NameCF835332
Unique NameCF835332
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length764
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1296 contig Csv1_Contig1296:822..1585. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835332 vs. ExPASy Swiss-Prot
Match: ASP_THECC (21 kDa seed protein OS=Theobroma cacao GN=ASP PE=2 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 7.990e-29
Identity = 68/173 (39.31%), Postives = 103/173 (59.54%), Query Frame = -3
Query:  241 PLLDVHGNKVESTIKYYIVSAIWXXXXXXXXXXXXXXGYCPLDVIQLPSDMQNGIELTLSPYNNST-IVRESTDLNLRFSVLLSGRD-YCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGIYKIVHCPSVCESCVKLCHNVGR-SFEDGVRRLVL 750
            P+LD  G+++++ ++YY++S+I                 CP  V+Q  SD+ NG  +  S  ++   +VR STD+N+ F  +   RD  C+   +W++DNYD ++GKW++TT G+ G PG  TL +WFK+EK G     YK   CPSVC+SC  LC ++GR S +DG  RL L
Sbjct:   30 PVLDTDGDELQTGVQYYVLSSISGAGGGGLALGRATGQSCPEIVVQRRSDLDNGTPVIFSNADSKDDVVRVSTDVNIEFVPI---RDRLCSTSTVWRLDNYDNSAGKWWVTTDGVKGEPGPNTLCSWFKIEKAGVLG--YKFRFCPSVCDSCTTLCSDIGRHSDDDGQIRLAL 197          
BLAST of CF835332 vs. ExPASy Swiss-Prot
Match: MIRA_RICDU (Miraculin OS=Richadella dulcifica PE=1 SV=3)

HSP 1 Score: 114.39 bits (285), Expect = 7.000e-25
Identity = 64/185 (34.59%), Postives = 96/185 (51.89%), Query Frame = -3
Query:  217 SVPEPLLDVHGNKVESTIKYYIVSAI--WXXXXXXXXXXXXXXGYCPLDVIQLPSDMQNGIELTLSPYN-NSTIVRESTDLNLRFSVLLSGRDYCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGIYKIVHCPSVCESCVKLCHNVGRSFEDGVRRLVLVRDDEPAF 762
            S P P+LD+ G K+ +   YYIV  +                   CP  V+Q   ++ +   L   P N    +VR STDLN+ FS  +  R       +W++D YD ++G++F+T GG+ G+PG ET+ +WFK+E+     G YK+V CP+VC SC   C +VG   +   RR + + D   AF
Sbjct:   31 SAPNPVLDIDGEKLRTGTNYYIVPVLRDHGGGLTVSATTPNGTFVCPPRVVQTRKEVDHDRPLAFFPENPKEDVVRVSTDLNINFSAFMPCR--WTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEEFCG-SGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALSDKPFAF 212          
BLAST of CF835332 vs. ExPASy Swiss-Prot
Match: LSPI_CARPA (Latex serine proteinase inhibitor OS=Carica papaya PE=1 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 6.780e-20
Identity = 64/179 (35.75%), Postives = 92/179 (51.40%), Query Frame = -3
Query:  232 PEPLLDVHGNKVESTIKYYIVSAIWXXXXXXXXXXXXXXGY-CPLDVIQLPSDMQNGIELTLSPYNN--STIVRESTDLNLRFSVLLSGRDYCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGIYKIVHCPSVCESCVKLCHNVGRSFED-GVRRLVLVRD 756
            P+P++D+ G  V   + Y++VSAIW                 CPL V+Q P D  NG  +  S   N    IV ES DLN++F++ ++    CNE   WKVD +    G W +T GG  G+ G E+  + FK++K G  P  YK   CPS   + +  C+NV   F+   +RRL+L  D
Sbjct:    3 PKPIVDIDGKPVLYGVDYFVVSAIWGAGGGGLTVYGPGNKKKCPLSVVQDPFD--NGEPIIFSAIKNVKDNIVFESVDLNVKFNITIN----CNETTAWKVDRFPGVIG-WTVTLGGEKGYHGFESTHSMFKIKKAG-LPFSYKFHFCPSYPRTRLIPCNNVDIFFDKYRIRRLILTND 173          
BLAST of CF835332 vs. ExPASy Swiss-Prot
Match: DRTI_DELRE (Kunitz-type serine protease inhibitor DrTI OS=Delonix regia PE=1 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.617e-13
Identity = 57/185 (30.81%), Postives = 87/185 (47.03%), Query Frame = -3
Query:  202 EPLLDVHGNKVESTIKYYIVSAIWXXXXXXXXXXXXXXGYCPLDVIQLPSDMQNGIELTLS-PYNNSTIVRESTDLNLRFSVLLSGRDYCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGIYKIVHCPSVCESCVKLCHNVGRSFEDGVRRLVLVRDDEPAFPVVLI 753
            E + D+ G  V    +YYIVSAI                 CP+ +IQ  SD+Q G+ +  S P  +   +   T+L + F      +  C E   W +      SG+  +  GG + HP  E +  +FK+EK+G+    YK+V CP   +S    C ++G ++E G R LVL   D+  F VV +
Sbjct:    4 EKVYDIEGYPVFLGSEYYIVSAIIGAGGGGVRPGRTRGSMCPMSIIQEQSDLQMGLPVRFSSPEESQGKIYTDTELEIEFVE----KPDCAESSKWVIVK---DSGEARVAIGGSEDHPQGELVRGFFKIEKLGSL--AYKLVFCP---KSSSGSCSDIGINYE-GRRSLVLKSSDDSPFRVVFV 175          
BLAST of CF835332 vs. ExPASy Swiss-Prot
Match: SPOR1_IPOBA (Sporamin A OS=Ipomoea batatas PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 6.796e-12
Identity = 55/188 (29.26%), Postives = 87/188 (46.28%), Query Frame = -3
Query:  199 PLLDVHGNKVESTIKYYIVSAIW-XXXXXXXXXXXXXXGYCPLDVIQLPSDMQNGIELTLSPYN---NSTIVRESTDLNLRFSVLLSGRDYCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGIYKIVHCPSVCESCVKLCHNVGRSFEDGVRRLVLVRDDEPAFPVVLIP 750
            P+LD++G++V +   YY+VSAIW                 C  DVI  P+D+ NG  +T++P      ST+V  ST    RF++  +    C     W +  +D+ASG++F+  G            N FK+E +      YK+ +C    +     C+NVGR  +  +R   L   + P F  V+ P
Sbjct:   42 PVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLDMMSKCATDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNI--ATNKLCVNNVNWGI-QHDSASGQYFLKAGEF-----VSDNSNQFKIELVDANLNSYKLTYCQFGSDK----CYNVGRFHDHMLRTTRLALSNSP-FVFVIKP 216          
BLAST of CF835332 vs. ExPASy Swiss-Prot
Match: SPORB_IPOBA (Sporamin B OS=Ipomoea batatas GN=GSPO-B1 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.514e-11
Identity = 56/187 (29.95%), Postives = 86/187 (45.99%), Query Frame = -3
Query:  199 PLLDVHGNKVESTIKYYIVSAIW--XXXXXXXXXXXXXXGYCPLDVIQLPSDMQNGIELTLSPYN-NSTIVRESTDLNLRFSVLLSGRDYCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGIYKIVHCPSVCESCVKLCHNVGRSFEDGVRRLVLVRDDEPAFPVVLIP 750
            P+LD++G++V +   YYIVSAIW                  C  DVI   SD  NG  +T++P +  +T+V  ST    RF++  +    C     W +  +D+ SG++F+  G            N FK+E + +    YKI    S C+   + C NVGR ++   R   L   + P F  V+ P
Sbjct:   40 PVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVRLDSSSNECASDVIVSRSDFDNGDPITITPADPEATVVMPSTYQTFRFNI--ATNKLCVNNVNWGI-KHDSESGQYFVKAGEF-----VSDNSNQFKIEVVNDNLNAYKI----SYCQFGTEKCFNVGRYYDPLTRATRLALSNTP-FVFVIKP 213          
BLAST of CF835332 vs. ExPASy Swiss-Prot
Match: SPOR2_IPOBA (Sporamin B OS=Ipomoea batatas PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 5.753e-11
Identity = 55/187 (29.41%), Postives = 86/187 (45.99%), Query Frame = -3
Query:  199 PLLDVHGNKVESTIKYYIVSAIW--XXXXXXXXXXXXXXGYCPLDVIQLPSDMQNGIELTLSPYN-NSTIVRESTDLNLRFSVLLSGRDYCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGIYKIVHCPSVCESCVKLCHNVGRSFEDGVRRLVLVRDDEPAFPVVLIP 750
            P+LD++G++V +   YY+VSAIW                  C  DVI   SD  NG  +T++P +  +T+V  ST    RF++  +    C     W +  +D+ SG++F+  G            N FK+E + +    YKI    S C+   + C NVGR ++   R   L   + P F  V+ P
Sbjct:   40 PVLDINGDEVRAGENYYMVSAIWGAGGGGLRLVRLDSSSNECASDVIVSRSDFDNGDPITITPADPEATVVMPSTYQTFRFNI--ATNKLCVNNVNWGI-KHDSESGQYFVKAGEF-----VSDNSNQFKIEVVNDNLNAYKI----SYCQFGTEKCFNVGRYYDPLTRATRLALSNIP-FVFVIKP 213          
The following BLAST results are available for this feature:
BLAST of CF835332 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
ASP_THECC7.990e-2939.3121 kDa seed protein OS=Theobroma cacao GN=ASP PE=2... [more]
MIRA_RICDU7.000e-2534.59Miraculin OS=Richadella dulcifica PE=1 SV=3[more]
LSPI_CARPA6.780e-2035.75Latex serine proteinase inhibitor OS=Carica papaya... [more]
DRTI_DELRE1.617e-1330.81Kunitz-type serine protease inhibitor DrTI OS=Delo... [more]
SPOR1_IPOBA6.796e-1229.26Sporamin A OS=Ipomoea batatas PE=2 SV=1[more]
SPORB_IPOBA1.514e-1129.95Sporamin B OS=Ipomoea batatas GN=GSPO-B1 PE=2 SV=1[more]
SPOR2_IPOBA5.753e-1129.41Sporamin B OS=Ipomoea batatas PE=2 SV=1[more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01A24_f Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01A24, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835332 ID=CF835332|Name=CF835332|organism=Citrus sinensis|type=EST|length=764bp
TTTTTTTTTTTTTTTTTCGATTTTCATAAGGTATACACCAACCCCTTAAT
TTATTAACCCCGAAAGGATCACAGGGTACTTATTCATAATTTTAATCCTA
GAGATTAAAGAGCAGCTAGCCTGGTCCGTTATTTAGAATAATAATACCGC
TAGCTGGTTAGGGTACATTGATTACACAGACGTTGATCTTTCTGTAGCGG
GAATTAACACAACAGGAAATGCCGGCTCATCATCACGAACCAGAACCAGA
CGTCGAACGCCATCCTCAAACGAACGGCCAACGTTGTGGCAGAGTTTGAC
ACAAGACTCGCAAACGGATGGACAATGAACGATTTTGTATATACCTGGAA
AATTTCCAATTTTCTCAAGCTTAAACCAATTTAGCAAAGTTTCAGCTCCA
GGGTGACCATCAAGTCCCCCGGTTGTTATAAACCATTTGCCTGATGCCGC
GTCATAATTATCAACTTTCCACAACGGTTGTTCGTTACAATAGTCACGTC
CAGATAGCAACACTGAGAATCTCAAGTTGAGATCAGTGGATTCTCGGACA
ATTGTAGAATTGTTATACGGTGACAGTGTTAATTCGATTCCATTTTGCAT
ATCAGAAGGTAACTGGATAACGTCCAGCGGACAATATCCGTTTCTGCCAC
CGTGTAGGCTAACTCCACCACCGCCAGCTCCCCAGATGGCTGAGACTATG
TAGTACTTAATGGTGGATTCGACCTTGTTGCCGTGGACATCAAGGAGAGG
TTCAGGAACTGATG
back to top