CF835368

Overview
NameCF835368
Unique NameCF835368
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length686
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CF835368_ssr362 microsatellite CF835368_ssr362:362..377. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7102 contig Csv1_Contig7102:820..1499. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835368 vs. ExPASy Swiss-Prot
Match: CHI9_ORYSJ (Chitinase 9 OS=Oryza sativa subsp. japonica GN=Cht9 PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 6.622e-13
Identity = 36/96 (37.50%), Postives = 49/96 (51.04%), Query Frame = 3
Query:    3 AIWTWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAFN 290
            A+W WMTP +  +PS HD   G W P+  D  + R P +G   NI+ G   CG G  D + N +  Y  Y D+LG+G         L C +Q+ FN
Sbjct:  238 ALWFWMTP-QSPKPSCHDVITGQWTPSSGDIAAGRVPGYGVITNIINGGLECGFGPDDRVANRIGFYQRYCDVLGIGY-----GSNLDCYDQRPFN 327          
BLAST of CF835368 vs. ExPASy Swiss-Prot
Match: CHI1_TOBAC (Endochitinase A OS=Nicotiana tabacum GN=CHN48 PE=1 SV=2)

HSP 1 Score: 74.3294 bits (181), Expect = 6.622e-13
Identity = 34/95 (35.79%), Postives = 50/95 (52.63%), Query Frame = 3
Query:    3 AIWTWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 287
            A+W WMTP +  +PS HD  +G W+P+  D  + R P FG   NI+ G   CG+G    + + +  Y  Y  +LGV      P + L C  Q++F
Sbjct:  232 ALWFWMTP-QSPKPSCHDVIIGRWQPSAGDRAANRLPGFGVITNIINGGLECGRGTDSRVQDRIGFYRRYCSILGV-----SPGDNLDCGNQRSF 320          
BLAST of CF835368 vs. ExPASy Swiss-Prot
Match: CHIC_SOLLC (Basic 30 kDa endochitinase OS=Solanum lycopersicum GN=CHI9 PE=1 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 8.648e-13
Identity = 36/95 (37.89%), Postives = 48/95 (50.53%), Query Frame = 3
Query:    3 AIWTWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 287
            AIW WMTP +  +PS HD   G W+P+  D  + R P FG   NI+ G   CG G    + + +  Y  Y  +LGV      P E L C  Q++F
Sbjct:  225 AIWFWMTP-QSPKPSCHDVITGRWQPSGADQAANRVPGFGVITNIINGGLECGHGSDSRVQDRIGFYRRYCGILGV-----SPGENLDCGNQRSF 313          
BLAST of CF835368 vs. ExPASy Swiss-Prot
Match: CHI2_TOBAC (Endochitinase B OS=Nicotiana tabacum GN=CHN50 PE=1 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 8.648e-13
Identity = 34/95 (35.79%), Postives = 50/95 (52.63%), Query Frame = 3
Query:    3 AIWTWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 287
            A+W WMTP +  +PS HD  +G W+P+  D  + R P FG   NI+ G   CG+G    + + +  Y  Y  +LGV      P + L C  Q++F
Sbjct:  227 ALWFWMTP-QSPKPSCHDVIIGRWQPSSADRAANRLPGFGVITNIINGGLECGRGTDSRVQDRIGFYRRYCSILGV-----SPGDNLDCGNQRSF 315          
BLAST of CF835368 vs. ExPASy Swiss-Prot
Match: CHIQ_TOBAC (Acidic endochitinase Q OS=Nicotiana tabacum PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.129e-12
Identity = 36/95 (37.89%), Postives = 51/95 (53.68%), Query Frame = 3
Query:    3 AIWTWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 287
            AIW WMTP + ++PS+HD  +G W P+  D  + R P +G   NI+ G   CG G  DA+ + + +Y  Y  +L V      P E L C  Q+ F
Sbjct:  162 AIWFWMTP-QDNKPSSHDVIIGRWTPSAADQAANRVPGYGVITNIINGGIECGIGRNDAVEDRIGYYRRYCGMLNV-----APGENLDCYNQRNF 250          
BLAST of CF835368 vs. ExPASy Swiss-Prot
Match: CHI2_SOLTU (Endochitinase 2 (Fragment) OS=Solanum tuberosum GN=CHTB2 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.129e-12
Identity = 35/95 (36.84%), Postives = 48/95 (50.53%), Query Frame = 3
Query:    3 AIWTWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 287
            AIW WMTP +  +PS HD   G W+P+  D  + R P FG   NI+ G   CG G    + + +  Y  Y  +LGV      P + L C  Q++F
Sbjct:  219 AIWFWMTP-QSPKPSCHDVITGRWQPSGTDQAANRVPGFGVITNIINGGLECGHGSDSRVQDRIGFYRRYCGILGV-----SPGDNLDCGNQRSF 307          
BLAST of CF835368 vs. ExPASy Swiss-Prot
Match: CHI3_SOLTU (Endochitinase 3 (Fragment) OS=Solanum tuberosum GN=CHTB3 PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.927e-12
Identity = 35/95 (36.84%), Postives = 48/95 (50.53%), Query Frame = 3
Query:    3 AIWTWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 287
            AIW WMTP +  +PS HD   G W+P+  D  + R P FG   NI+ G   CG G    + + +  Y  Y  +LGV      P + L C  Q++F
Sbjct:  221 AIWFWMTP-QSPKPSCHDVITGRWQPSGADQAANRVPGFGVITNIINGGLECGHGSDSRVQDRIGFYRRYCGILGV-----SPGDNLDCGNQRSF 309          
BLAST of CF835368 vs. ExPASy Swiss-Prot
Match: CHI1_SOLTU (Endochitinase 1 (Fragment) OS=Solanum tuberosum GN=CHTB1 PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.516e-12
Identity = 35/95 (36.84%), Postives = 48/95 (50.53%), Query Frame = 3
Query:    3 AIWTWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 287
            AIW WMTP +  +PS HD   G W+P+  D  + R P FG   NI+ G   CG G    + + +  Y  Y  +LGV      P + L C  Q++F
Sbjct:  221 AIWFWMTP-QSPKPSCHDVITGRWQPSGVDQAANRVPGFGVITNIINGGLECGHGSDSRVQDRIGFYRRYCGILGV-----SPGDNLDCGNQRSF 309          
BLAST of CF835368 vs. ExPASy Swiss-Prot
Match: CHIT_SOLTU (Endochitinase OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 4.292e-12
Identity = 34/95 (35.79%), Postives = 49/95 (51.58%), Query Frame = 3
Query:    3 AIWTWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 287
            A+W WMTP +  +PS HD  +G W P+  D  + R P FG   NI+ G   CG+G  + + + +  Y  Y  +LGV      P + L C  Q+ F
Sbjct:  231 ALWFWMTP-QSPKPSCHDVIIGRWNPSSADRAANRLPGFGVITNIINGGLECGRGTDNRVQDRIGFYRRYCSILGV-----TPGDNLDCVNQRWF 319          
BLAST of CF835368 vs. ExPASy Swiss-Prot
Match: CHID_SOLLC (Basic endochitinase (Fragment) OS=Solanum lycopersicum GN=CHI14 PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 5.606e-12
Identity = 36/95 (37.89%), Postives = 47/95 (49.47%), Query Frame = 3
Query:    3 AIWTWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 287
            A+W WMT  ++ +PSAHD   G W P+  D+   R P FG   NI+ G   C  G    M+N +  Y  Y  +LGV      P   L CA Q+ F
Sbjct:  157 ALWFWMT-AQQPKPSAHDVITGRWSPSVADSAPGRVPGFGVITNIINGGMECNSGSNALMDNRIGFYRRYCQILGV-----DPGNNLDCANQRPF 245          
The following BLAST results are available for this feature:
BLAST of CF835368 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 20
Match NameE-valueIdentityDescription
CHI9_ORYSJ6.622e-1337.50Chitinase 9 OS=Oryza sativa subsp. japonica GN=Cht... [more]
CHI1_TOBAC6.622e-1335.79Endochitinase A OS=Nicotiana tabacum GN=CHN48 PE=1... [more]
CHIC_SOLLC8.648e-1337.89Basic 30 kDa endochitinase OS=Solanum lycopersicum... [more]
CHI2_TOBAC8.648e-1335.79Endochitinase B OS=Nicotiana tabacum GN=CHN50 PE=1... [more]
CHIQ_TOBAC1.129e-1237.89Acidic endochitinase Q OS=Nicotiana tabacum PE=1 S... [more]
CHI2_SOLTU1.129e-1236.84Endochitinase 2 (Fragment) OS=Solanum tuberosum GN... [more]
CHI3_SOLTU1.927e-1236.84Endochitinase 3 (Fragment) OS=Solanum tuberosum GN... [more]
CHI1_SOLTU2.516e-1236.84Endochitinase 1 (Fragment) OS=Solanum tuberosum GN... [more]
CHIT_SOLTU4.292e-1235.79Endochitinase OS=Solanum tuberosum PE=2 SV=1[more]
CHID_SOLLC5.606e-1237.89Basic endochitinase (Fragment) OS=Solanum lycopers... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01C01_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01C01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835368 ID=CF835368|Name=CF835368|organism=Citrus sinensis|type=EST|length=686bp
CTGCAATTTGGACTTGGATGACCCCAGTCAAGAAATCCCAGCCTTCAGCC
CATGATGCCTTTGTTGGCAACTGGAAGCCCACCAAGAATGATACTTTGTC
CAAACGGGGACCTAACTTTGGTACCACAATGAATATCCTCTATGGTGAGA
GCGTATGCGGTCAGGGTGATATTGATGCTATGAACAACATTGTCTCTCAT
TACTTGTATTACCTTGATCTGTTGGGTGTTGGCCGAGAGCAGGCAGGACC
TAATGAAGAACTCTCTTGTGCTGAGCAGAAAGCCTTCAACCCAAACACCG
CACCTTCAGCTGCATCTTCTTGAGGACGTTTATTGTAGCCAAGCTATTAT
TGTGGGAGTGACTCTCTCTCTCTCTCTAGGTGGGTACCATTACAATAAGA
CTGGGGTTAATTAAACTATTTGTTGTAAGTTTTTTTTTTTTTTTCCATCT
TTTCATATATTGCGCAAGGTCAATTAGTGTGTGGATTGGTCTGCCCCTCT
TCATTGCCGCTGTAGATTTGAGATTCATTTGGTTTGTAAAATCTTCGTTA
TATCTGGTTACATATGTAATGATGAACCGCATGAACCACTCGTGTGTTTC
AATAGCAGAATTGTAAAGTATATGCTTATATTCCATTTATTCCGGGATAT
CGACTCTTAGTTTCGTTTTTAAAAAAAAAAAAAAAA
back to top