CF835374

Overview
NameCF835374
Unique NameCF835374
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length776
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3442 contig Csv1_Contig3442:310..1085. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835374 vs. ExPASy Swiss-Prot
Match: RS4_SOLTU (40S ribosomal protein S4 OS=Solanum tuberosum GN=RPS4 PE=2 SV=1)

HSP 1 Score: 330.872 bits (847), Expect = 4.840e-90
Identity = 157/170 (92.35%), Postives = 167/170 (98.24%), Query Frame = -2
Query:  266 FMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEENKITDFIKFDVGNIVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGSKPWVSLPKGKGIKLSIIEEARKR 775
            FMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEE+KFKLCKVRSVQFGQKGIPY+NTYDGRTIRYPDPLIKANDTIKLDLE NKI DFIKFDVGN+VMVTGGRNRGRVG+IKNREKHKGSFET+HIQD+ GHEFATRLGNVFT+GKG+KPWVSLPKGKGIKL+IIE+ARKR
Sbjct:   86 FMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEESKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETLHIQDSQGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIEDARKR 255          
BLAST of CF835374 vs. ExPASy Swiss-Prot
Match: RS4_PRUAR (40S ribosomal protein S4 OS=Prunus armeniaca GN=RPS4 PE=2 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 8.256e-90
Identity = 157/168 (93.45%), Postives = 166/168 (98.81%), Query Frame = -2
Query:  266 DVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEENKITDFIKFDVGNIVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGSKPWVSLPKGKGIKLSIIEEARKR 769
            DVVSIPKTNENFRLLYDTKGRFRLHS+RDEE+KFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLE NKITDFIKFDVGN+VMVTGGRNRGRVG+IKNREKHKGSFETIH+QDA GHEFATRLGNVFTIGKG+KPWVSLPKGKGIKL+I+EEA+KR
Sbjct:   84 DVVSIPKTNENFRLLYDTKGRFRLHSIRDEESKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITDFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTILEEAKKR 251          
BLAST of CF835374 vs. ExPASy Swiss-Prot
Match: RS42_ARATH (40S ribosomal protein S4-2 OS=Arabidopsis thaliana GN=RPS4B PE=2 SV=4)

HSP 1 Score: 330.102 bits (845), Expect = 8.256e-90
Identity = 156/170 (91.76%), Postives = 167/170 (98.24%), Query Frame = -2
Query:  266 FMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEENKITDFIKFDVGNIVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGSKPWVSLPKGKGIKLSIIEEARKR 775
            FMDVVSIPKTNENFRLLYDTKGRFRLHS++DEEAKFKLCKVRS+QFGQKGIPY+NTYDGRTIRYPDPLIK NDTIKLDLEENKI +FIKFDVGN+VMVTGGRNRGRVG+IKNREKHKGSFETIHIQD+ GHEFATRLGNV+TIGKG+KPWVSLPKGKGIKL+IIEEARKR
Sbjct:   86 FMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTIGKGTKPWVSLPKGKGIKLTIIEEARKR 255          
BLAST of CF835374 vs. ExPASy Swiss-Prot
Match: RS41_ARATH (40S ribosomal protein S4-1 OS=Arabidopsis thaliana GN=RPS4A PE=2 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 8.256e-90
Identity = 156/170 (91.76%), Postives = 167/170 (98.24%), Query Frame = -2
Query:  266 FMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEENKITDFIKFDVGNIVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGSKPWVSLPKGKGIKLSIIEEARKR 775
            FMDVVSIPKTNENFRLLYDTKGRFRLHS++DEEAKFKLCKVRS+QFGQKGIPY+NTYDGRTIRYPDPLIK NDTIKLDLEENKI +FIKFDVGN+VMVTGGRNRGRVG+IKNREKHKGSFETIHIQD+ GHEFATRLGNV+TIGKG+KPWVSLPKGKGIKL+IIEEARKR
Sbjct:   86 FMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTIGKGTKPWVSLPKGKGIKLTIIEEARKR 255          
BLAST of CF835374 vs. ExPASy Swiss-Prot
Match: RS43_ARATH (40S ribosomal protein S4-3 OS=Arabidopsis thaliana GN=RPS4D PE=2 SV=2)

HSP 1 Score: 327.791 bits (839), Expect = 4.097e-89
Identity = 155/170 (91.18%), Postives = 166/170 (97.65%), Query Frame = -2
Query:  266 FMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEENKITDFIKFDVGNIVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGSKPWVSLPKGKGIKLSIIEEARKR 775
            FMDVVSIPKTNENFRLLYDTKGRFRLHS++DEEAKFKLCKVRS+QFGQKGIPY+NTYDGRTIRYPDPLIK NDTIKLDLE NKI +FIKFDVGN+VMVTGGRNRGRVG+IKNREKHKGSFETIHIQD+ GHEFATRLGNV+TIGKG+KPWVSLPKGKGIKL+IIEEARKR
Sbjct:   86 FMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTIGKGTKPWVSLPKGKGIKLTIIEEARKR 255          
BLAST of CF835374 vs. ExPASy Swiss-Prot
Match: RS4_MAIZE (40S ribosomal protein S4 OS=Zea mays GN=RPS4 PE=2 SV=1)

HSP 1 Score: 323.939 bits (829), Expect = 5.916e-88
Identity = 151/170 (88.82%), Postives = 165/170 (97.06%), Query Frame = -2
Query:  266 FMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEENKITDFIKFDVGNIVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGSKPWVSLPKGKGIKLSIIEEARKR 775
            FMDV+SIPKTNEN+RLLYDTKGRFRLH +RDE+AKFKLCKVRSVQFGQKGIPY+NTYDGRTIRYPDPLIKANDTIK+DLE NKI DFIKFDVGN+VMVTGGRN GRVG+IKNREKHKGSFETIH++D+LGH+FATR+GNVFTIGKG+KPWVSLPKGKGIKLSIIEE RKR
Sbjct:   86 FMDVISIPKTNENYRLLYDTKGRFRLHPIRDEDAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNVVMVTGGRNTGRVGVIKNREKHKGSFETIHVEDSLGHQFATRMGNVFTIGKGNKPWVSLPKGKGIKLSIIEEQRKR 255          
BLAST of CF835374 vs. ExPASy Swiss-Prot
Match: RS4_ORYSJ (40S ribosomal protein S4 OS=Oryza sativa subsp. japonica GN=RPS4 PE=2 SV=3)

HSP 1 Score: 320.087 bits (819), Expect = 8.543e-87
Identity = 150/170 (88.24%), Postives = 164/170 (96.47%), Query Frame = -2
Query:  266 FMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEENKITDFIKFDVGNIVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGSKPWVSLPKGKGIKLSIIEEARKR 775
            FMDV+SIPKT EN+RLLYDTKGRFRL S++DE+AKFKLCKVRSVQFGQKGIPY+NTYDGRTIRYPDP+IKANDTIK+DLE NKI DFIKFDVGN+VMVTGGRN GRVG+IKNREKHKGSFETIH++DALGH+FATRLGNVFTIGKG+KPWVSLPKGKGIKLSIIEE RKR
Sbjct:   86 FMDVISIPKTGENYRLLYDTKGRFRLQSVKDEDAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPIIKANDTIKIDLETNKIVDFIKFDVGNVVMVTGGRNTGRVGVIKNREKHKGSFETIHVEDALGHQFATRLGNVFTIGKGNKPWVSLPKGKGIKLSIIEEQRKR 255          
BLAST of CF835374 vs. ExPASy Swiss-Prot
Match: RS4_GOSHI (40S ribosomal protein S4 OS=Gossypium hirsutum GN=RPS4 PE=2 SV=1)

HSP 1 Score: 319.316 bits (817), Expect = 1.457e-86
Identity = 153/170 (90.00%), Postives = 162/170 (95.29%), Query Frame = -2
Query:  266 FMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEENKITDFIKFDVGNIVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGSKPWVSLPKGKGIKLSIIEEARKR 775
            FMDVVSIPKTNE+FRLLYDTKGRF LH++  +E KFKLCKVRSVQFGQKGIPY+NTYDGRTIRYPDPLIKANDTIKLDLE NKI DFIKFDVGN+VMVTGGRNRGRVG+IKNREKHKGSFETIH+QDA GHEFATRLGNVFTIGKG+KPWVSLPK KGIKLSIIEEARKR
Sbjct:   86 FMDVVSIPKTNEDFRLLYDTKGRFCLHAITGDETKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTKPWVSLPKRKGIKLSIIEEARKR 255          
BLAST of CF835374 vs. ExPASy Swiss-Prot
Match: RS4_CRIGR (40S ribosomal protein S4 OS=Cricetulus griseus GN=RPS4 PE=2 SV=2)

HSP 1 Score: 253.832 bits (647), Expect = 7.519e-67
Identity = 115/170 (67.65%), Postives = 141/170 (82.94%), Query Frame = -2
Query:  266 FMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEENKITDFIKFDVGNIVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGSKPWVSLPKGKGIKLSIIEEARKR 775
            FMDV+SI KT ENFRL+YDTKGRF +H +  EEAK+KLCKVR +  G KGIP++ T+D RTIRYPDPLIK NDTI++DLE  KITDFIKFD GN+ MVTGG N GR+G+I NRE+H GSF+ +H++DA G+ FATRL N+F IGKG+KPW+SLP+GKGI+L+I EE  KR
Sbjct:   86 FMDVISIDKTGENFRLIYDTKGRFAVHRITSEEAKYKLCKVRKIFVGTKGIPHLVTHDARTIRYPDPLIKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLGRIGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGKGNKPWISLPRGKGIRLTIAEERDKR 255          
BLAST of CF835374 vs. ExPASy Swiss-Prot
Match: RS4_BOVIN (40S ribosomal protein S4 OS=Bos taurus GN=RPS4 PE=2 SV=3)

HSP 1 Score: 253.447 bits (646), Expect = 9.820e-67
Identity = 115/170 (67.65%), Postives = 141/170 (82.94%), Query Frame = -2
Query:  266 FMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEENKITDFIKFDVGNIVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGSKPWVSLPKGKGIKLSIIEEARKR 775
            FMDV+SI KT ENFRL+YDTKGRF +H +  EEAK+KLCKVR +  G KGIP++ T+D RTIRYPDPLIK NDTI++DLE  KITDFIKFD GN+ MVTGG N GR+G+I NRE+H GSF+ +H++DA G+ FATRL N+F IGKG+KPW+SLP+GKGI+L+I EE  KR
Sbjct:   86 FMDVISIDKTGENFRLIYDTKGRFAVHRITPEEAKYKLCKVRKIFVGTKGIPHLVTHDARTIRYPDPLIKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLGRIGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGKGNKPWISLPRGKGIRLTIAEERDKR 255          
The following BLAST results are available for this feature:
BLAST of CF835374 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 76
Match NameE-valueIdentityDescription
RS4_SOLTU4.840e-9092.3540S ribosomal protein S4 OS=Solanum tuberosum GN=R... [more]
RS4_PRUAR8.256e-9093.4540S ribosomal protein S4 OS=Prunus armeniaca GN=RP... [more]
RS42_ARATH8.256e-9091.7640S ribosomal protein S4-2 OS=Arabidopsis thaliana... [more]
RS41_ARATH8.256e-9091.7640S ribosomal protein S4-1 OS=Arabidopsis thaliana... [more]
RS43_ARATH4.097e-8991.1840S ribosomal protein S4-3 OS=Arabidopsis thaliana... [more]
RS4_MAIZE5.916e-8888.8240S ribosomal protein S4 OS=Zea mays GN=RPS4 PE=2 ... [more]
RS4_ORYSJ8.543e-8788.2440S ribosomal protein S4 OS=Oryza sativa subsp. ja... [more]
RS4_GOSHI1.457e-8690.0040S ribosomal protein S4 OS=Gossypium hirsutum GN=... [more]
RS4_CRIGR7.519e-6767.6540S ribosomal protein S4 OS=Cricetulus griseus GN=... [more]
RS4_BOVIN9.820e-6767.6540S ribosomal protein S4 OS=Bos taurus GN=RPS4 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01C05_f Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01C05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835374 ID=CF835374|Name=CF835374|organism=Citrus sinensis|type=EST|length=776bp
TTTTTTTTTTTTTTTTAAGAGATACATGAACTTAGATTAAATCTTTGAAA
ATAACATCCACCAAATAGTAGCTAAAATAAAAACGGACAAAGCAGGTTCA
AAATTGTGCTGATAAAAATAAAAATAAAAATAAAGATTCATTTTTGCATC
GGTCCTACTTCAGCTTTAGAGAGTGCCAATCAGCTCTAATTCAACAAGAA
AAAACAAAGCAGCAAAATGCATCCAAATTCATTGTAAAAGCTTAAGCAGC
AGCCTGGGCAGCCTGTCTCTTCCTAGCTTCCTCAATGATGGACAACTTAA
TACCCTTGCCCTTAGGAAGTGACACCCATGGTTTTGAACCCTTCCCGATG
GTGAACACATTGCCTAGACGAGTTGCAAACTCATGACCAAGGGCATCTTG
AATATGGATGGTCTCAAAACTTCCCTTATGCTTTTCCCTGTTCTTGATGA
TTCCAACTCGACCTCTGTTTCTACCCCCAGTGACCATGACAATATTCCCA
ACATCAAACTTGATGAAGTCAGTGATCTTGTTCTCTTCTAAGTCAAGTTT
GATGGTATCATTGGCTTTGATGAGTGGGTCAGGGTAGCGGATGGTACGCC
CATCATAGGTGTTGATGTATGGGATACCTTTCTGGCCAAACTGGACTGAT
CTAACTTTGCAAAGCTTGAATTTTGCCTCCTCATCTCTGAGGGAATGGAG
ACGGAAGCGACCCTTGGTGTCATAAAGGAGACGGAAGTTCTCGTTGGTCT
TGGGAATTGACACAACATCCATGAAA
back to top