CF835377

Overview
NameCF835377
Unique NameCF835377
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length771
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1103 contig Csv1_Contig1103:1..771. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835377 vs. ExPASy Swiss-Prot
Match: ERDL6_ARATH (Sugar transporter ERD6-like 6 OS=Arabidopsis thaliana GN=At1g75220 PE=1 SV=1)

HSP 1 Score: 364.385 bits (934), Expect = 3.923e-100
Identity = 183/230 (79.57%), Postives = 200/230 (86.96%), Query Frame = 1
Query:   85 MSFRDDNEEAAN-LRKPFLHTGSWYKMGXXXXXXXXXXAQMLRDGSXXXXXXXXXXALGPIQFGFTCGYSSPTQAEIISDLKLTISEFSIFGSLANVGAMVGAIASGQIAEYIGRKGSLMIAAVPNIIGWLIISFSKDSSFLFMGRLLEGFGVGVISYTVPVYIAEIAPQNMRGSLGSVNQLSVTIGIMLAYLLGLFVNWRVLAVLGVLPCTLLIPGLFFIPESPRWLAK 771
            MSFRDDNEEA N LR+PF+HTGSWY+MG          +Q++RD S          ALGPIQFGFTCGYSSPTQA I  DL LT+SE+S+FGSL+NVGAMVGAIASGQIAEYIGRKGSLMIAA+PNIIGWL ISF+KD+SFL+MGRLLEGFGVG+ISYTVPVYIAEIAPQNMRG LGSVNQLSVTIGIMLAYLLGLFV WR+LAVLG+LPCTLLIPGLFFIPESPRWLAK
Sbjct:    1 MSFRDDNEEARNDLRRPFIHTGSWYRMGSRQSSMMGS-SQVIRDSSISVLACVLIVALGPIQFGFTCGYSSPTQAAITKDLGLTVSEYSVFGSLSNVGAMVGAIASGQIAEYIGRKGSLMIAAIPNIIGWLCISFAKDTSFLYMGRLLEGFGVGIISYTVPVYIAEIAPQNMRGGLGSVNQLSVTIGIMLAYLLGLFVPWRILAVLGILPCTLLIPGLFFIPESPRWLAK 229          
BLAST of CF835377 vs. ExPASy Swiss-Prot
Match: ERDL4_ARATH (Sugar transporter ERD6-like 4 OS=Arabidopsis thaliana GN=At1g19450 PE=2 SV=1)

HSP 1 Score: 356.681 bits (914), Expect = 8.179e-98
Identity = 180/231 (77.92%), Postives = 198/231 (85.71%), Query Frame = 1
Query:   85 MSFRDDNEEAA--NLRKPFLHTGSWYKMGXXXXXXXXXXAQMLRDGSXXXXXXXXXXALGPIQFGFTCGYSSPTQAEIISDLKLTISEFSIFGSLANVGAMVGAIASGQIAEYIGRKGSLMIAAVPNIIGWLIISFSKDSSFLFMGRLLEGFGVGVISYTVPVYIAEIAPQNMRGSLGSVNQLSVTIGIMLAYLLGLFVNWRVLAVLGVLPCTLLIPGLFFIPESPRWLAK 771
            MSFRDDN E    +LR+PFLHTGSWY+MG          +Q++RD S          ALGPIQFGFTCGYSSPTQA I  DL LT+SE+S+FGSL+NVGAMVGAIASGQIAEY+GRKGSLMIAA+PNIIGWL ISF+KD+SFL+MGRLLEGFGVG+ISYTVPVYIAEIAPQ MRG+LGSVNQLSVTIGIMLAYLLGLFV WR+LAVLGVLPCTLLIPGLFFIPESPRWLAK
Sbjct:    1 MSFRDDNTEEGRNDLRRPFLHTGSWYRMGSRQSSMLES-SQVIRDSSISVLACVLIVALGPIQFGFTCGYSSPTQAAITKDLGLTVSEYSVFGSLSNVGAMVGAIASGQIAEYVGRKGSLMIAAIPNIIGWLSISFAKDTSFLYMGRLLEGFGVGIISYTVPVYIAEIAPQTMRGALGSVNQLSVTIGIMLAYLLGLFVPWRILAVLGVLPCTLLIPGLFFIPESPRWLAK 230          
BLAST of CF835377 vs. ExPASy Swiss-Prot
Match: ERDL7_ARATH (Sugar transporter ERD6-like 7 OS=Arabidopsis thaliana GN=At2g48020 PE=2 SV=2)

HSP 1 Score: 196.052 bits (497), Expect = 1.848e-49
Identity = 90/172 (52.33%), Postives = 125/172 (72.67%), Query Frame = 1
Query:  256 GPIQFGFTCGYSSPTQAEIISDLKLTISEFSIFGSLANVGAMVGAIASGQIAEYIGRKGSLMIAAVPNIIGWLIISFSKDSSFLFMGRLLEGFGVGVISYTVPVYIAEIAPQNMRGSLGSVNQLSVTIGIMLAYLLGLFVNWRVLAVLGVLPCTLLIPGLFFIPESPRWLAK 771
            G   FG   GYSSP QA I +DL LTI+EFS+FGSL   GAM+GAI SG IA+ +GRKG++ +++   ++GWL I F+K    L +GRL  G+G+G  SY VP++IAEIAP+  RG+L ++NQ+ +  G+ +++++G  V WRVLA++G++PC     GLFFIPESPRWLAK
Sbjct:   38 GSFAFGSCAGYSSPAQAAIRNDLSLTIAEFSLFGSLLTFGAMIGAITSGPIADLVGRKGAMRVSSAFCVVGWLAIIFAKGVVALDLGRLATGYGMGAFSYVVPIFIAEIAPKTFRGALTTLNQILICTGVSVSFIIGTLVTWRVLALIGIIPCAASFLGLFFIPESPRWLAK 209          
BLAST of CF835377 vs. ExPASy Swiss-Prot
Match: EDL16_ARATH (Sugar transporter ERD6-like 16 OS=Arabidopsis thaliana GN=At5g18840 PE=2 SV=2)

HSP 1 Score: 192.2 bits (487), Expect = 2.668e-48
Identity = 87/172 (50.58%), Postives = 128/172 (74.42%), Query Frame = 1
Query:  256 GPIQFGFTCGYSSPTQAEIISDLKLTISEFSIFGSLANVGAMVGAIASGQIAEYIGRKGSLMIAAVPNIIGWLIISFSKDSSFLFMGRLLEGFGVGVISYTVPVYIAEIAPQNMRGSLGSVNQLSVTIGIMLAYLLGLFVNWRVLAVLGVLPCTLLIPGLFFIPESPRWLAK 771
            G  +FG   GYS+PTQ+ I  DL L+++EFS+FGS+  +GAM+GA+ SG+I+++ GRKG++  +A   I GWL + F+K +  L +GR   G+G+GV SY VPVYIAEI+P+N+RG L ++NQL + IG  +++L+G  ++W+ LA+ G+ PC +L+ GL FIPESPRWLAK
Sbjct:   54 GSFEFGSCVGYSAPTQSSIRQDLNLSLAEFSMFGSILTIGAMLGAVMSGKISDFSGRKGAMRTSACFCITGWLAVFFTKGALLLDVGRFFTGYGIGVFSYVVPVYIAEISPKNLRGGLTTLNQLMIVIGSSVSFLIGSLISWKTLALTGLAPCIVLLFGLCFIPESPRWLAK 225          
BLAST of CF835377 vs. ExPASy Swiss-Prot
Match: ERDL8_ARATH (Sugar transporter ERD6-like 8 OS=Arabidopsis thaliana GN=At3g05150 PE=2 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 3.853e-47
Identity = 87/170 (51.18%), Postives = 126/170 (74.12%), Query Frame = 1
Query:  256 GPIQFGFTCGYSSPTQAEIISDLKLTISEFSIFGSLANVGAMVGAIASGQIAEYIGRKGSLMIAAVPNIIGWLIISFSKDSSFLFMGRLLEGFGVGVISYTVPVYIAEIAPQNMRGSLGSVNQLSVTIGIMLAYLLGLFVNWRVLAVLGVLPCTLLIPGLFFIPESPRWL 765
            G  +FG   GYS+PTQ  I+ +L L+ S+FS+FGS+ N+GA++GAI SG+I+++IGRKG++ +++V + IGWLII  +K    L  GR L G+G G +S+ VPV+IAEI+P+ +RG+L ++NQL + IG+   +L+G  VNWR LA+ GV PC +L  G +FIPESPRWL
Sbjct:   45 GSYEFGTCVGYSAPTQFGIMEELNLSYSQFSVFGSILNMGAVLGAITSGKISDFIGRKGAMRLSSVISAIGWLIIYLAKGDVPLDFGRFLTGYGCGTLSFVVPVFIAEISPRKLRGALATLNQLFIVIGLASMFLIGAVVNWRTLALTGVAPCVVLFFGTWFIPESPRWL 214          
BLAST of CF835377 vs. ExPASy Swiss-Prot
Match: ERDL5_ARATH (Sugar transporter ERD6-like 5 OS=Arabidopsis thaliana GN=At1g54730 PE=2 SV=2)

HSP 1 Score: 186.808 bits (473), Expect = 1.121e-46
Identity = 84/172 (48.84%), Postives = 126/172 (73.26%), Query Frame = 1
Query:  256 GPIQFGFTCGYSSPTQAEIISDLKLTISEFSIFGSLANVGAMVGAIASGQIAEYIGRKGSLMIAAVPNIIGWLIISFSKDSSFLFMGRLLEGFGVGVISYTVPVYIAEIAPQNMRGSLGSVNQLSVTIGIMLAYLLGLFVNWRVLAVLGVLPCTLLIPGLFFIPESPRWLAK 771
            G   FG   GYSSP Q+++  +L L+++E+S+FGS+  +GAM+GA  SG+IA+ IGR+ ++  + +  I+GWL I  SK + +L +GR L G+G+GV S+ VPVYIAEI P+ +RG   +V+QL + +G+ + YLLG F+ WR+LA++G++PC + + GLF IPESPRWLAK
Sbjct:   42 GSFVFGSAIGYSSPVQSDLTKELNLSVAEYSLFGSILTIGAMIGAAMSGRIADMIGRRATMGFSEMFCILGWLAIYLSKVAIWLDVGRFLVGYGMGVFSFVVPVYIAEITPKGLRGGFTTVHQLLICLGVSVTYLLGSFIGWRILALIGMIPCVVQMMGLFVIPESPRWLAK 213          
BLAST of CF835377 vs. ExPASy Swiss-Prot
Match: EDL14_ARATH (Sugar transporter ERD6-like 14 OS=Arabidopsis thaliana GN=At4g04750 PE=2 SV=2)

HSP 1 Score: 179.489 bits (454), Expect = 1.790e-44
Identity = 84/172 (48.84%), Postives = 123/172 (71.51%), Query Frame = 1
Query:  256 GPIQFGFTCGYSSPTQAEIISDLKLTISEFSIFGSLANVGAMVGAIASGQIAEYIGRKGSLMIAAVPNIIGWLIISFSKDSSFLFMGRLLEGFGVGVISYTVPVYIAEIAPQNMRGSLGSVNQLSVTIGIMLAYLLGLFVNWRVLAVLGVLPCTLLIPGLFFIPESPRWLAK 771
            G + FG   GY++PTQ+ I+ DL L+I++FS FGS+  VG ++GA+  G++A+ +GR  ++ I  +  +IGWL I+F+KD   L +GRLL+G  VG+ SY  P+YI+E+AP+N+RG+  S+ QL V +G+   Y LG  V WR LA+LG +P  +++P LFFIPESPRWLAK
Sbjct:   46 GALSFGCIVGYTAPTQSSIMKDLNLSIADFSFFGSILTVGLILGALICGKLADLVGRVYTIWITNILVLIGWLAIAFAKDVRLLDLGRLLQGISVGISSYLGPIYISELAPRNLRGAASSLMQLFVGVGLSAFYALGTAVAWRSLAILGSIPSLVVLPLLFFIPESPRWLAK 217          
BLAST of CF835377 vs. ExPASy Swiss-Prot
Match: ERDL3_ARATH (Sugar transporter ERD6-like 3 OS=Arabidopsis thaliana GN=SUGTL2 PE=2 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 3.987e-44
Identity = 84/172 (48.84%), Postives = 123/172 (71.51%), Query Frame = 1
Query:  256 GPIQFGFTCGYSSPTQAEIISDLKLTISEFSIFGSLANVGAMVGAIASGQIAEYIGRKGSLMIAAVPNIIGWLIISFSKDSSFLFMGRLLEGFGVGVISYTVPVYIAEIAPQNMRGSLGSVNQLSVTIGIMLAYLLGLFVNWRVLAVLGVLPCTLLIPGLFFIPESPRWLAK 771
            G   FG   GYSS  Q  II+DL L+++++S+FGS+   G M+GAI SG++A+ +GRKG++  A +  I GW+ ++ +KDS +L +GRL  GF VG++SY +PVYIAEI P+++RG+    NQL  + G+ L Y++G FV+WR LA++G++PC L +  LFFIPESPR L K
Sbjct:   42 GSFCFGCAAGYSSVAQTGIINDLGLSVAQYSMFGSIMTFGGMIGAIFSGKVADLMGRKGTMWFAQIFCIFGWVAVALAKDSMWLDIGRLSTGFAVGLLSYVIPVYIAEITPKHVRGAFVFANQLMQSCGLSLFYVIGNFVHWRNLALIGLIPCALQVVTLFFIPESPRLLGK 213          
BLAST of CF835377 vs. ExPASy Swiss-Prot
Match: EDL18_ARATH (Sugar transporter ERD6-like 18 OS=Arabidopsis thaliana GN=SFP2 PE=2 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 6.800e-44
Identity = 83/172 (48.26%), Postives = 122/172 (70.93%), Query Frame = 1
Query:  256 GPIQFGFTCGYSSPTQAEIISDLKLTISEFSIFGSLANVGAMVGAIASGQIAEYIGRKGSLMIAAVPNIIGWLIISFSKDSSFLFMGRLLEGFGVGVISYTVPVYIAEIAPQNMRGSLGSVNQLSVTIGIMLAYLLGLFVNWRVLAVLGVLPCTLLIPGLFFIPESPRWLAK 771
            G   FG + GY+S  +  I+ DL L+I++FS F SL+ +GA +GA+ SG++A  +GR+ ++ ++ +  IIGW  I+F+KD  +L  GR+  G G+G+ISY VPVYIAEI+P+++RG+    NQL    G+ + Y  G F+NWR+LA+LG LPC + + GLFF+PESPRWLAK
Sbjct:   45 GSFSFGVSLGYTSGAEIGIMKDLDLSIAQFSAFASLSTLGAAIGALFSGKMAIILGRRKTMWVSDLLCIIGWFSIAFAKDVMWLNFGRISSGIGLGLISYVVPVYIAEISPKHVRGTFTFTNQLLQNSGLAMVYFSGNFLNWRILALLGALPCFIQVIGLFFVPESPRWLAK 216          
BLAST of CF835377 vs. ExPASy Swiss-Prot
Match: EDL12_ARATH (Sugar transporter ERD6-like 12 OS=Arabidopsis thaliana GN=SUGTL5 PE=2 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 1.160e-43
Identity = 86/168 (51.19%), Postives = 117/168 (69.64%), Query Frame = 1
Query:  268 FGFTCGYSSPTQAEIISDLKLTISEFSIFGSLANVGAMVGAIASGQIAEYIGRKGSLMIAAVPNIIGWLIISFSKDSSFLFMGRLLEGFGVGVISYTVPVYIAEIAPQNMRGSLGSVNQLSVTIGIMLAYLLGLFVNWRVLAVLGVLPCTLLIPGLFFIPESPRWLAK 771
            FG   GY++ T + I+SDL L++++FS+FGSL+  G M+GAI S + A   G K +L +A +  I GWL IS +KD  +L MGR L G GVG+ISY VPVYIAEI P+++RG+    NQL    G+ + Y  G F++WR LA++G +PC + + GLFFIPESPRWLAK
Sbjct:   40 FGAAIGYTADTMSSIMSDLDLSLAQFSLFGSLSTFGGMIGAIFSAKAASAFGHKMTLWVADLFCITGWLAISLAKDIIWLDMGRFLVGIGVGLISYVVPVYIAEITPKHVRGAFTFSNQLLQNCGVAVVYYFGNFLSWRTLAIIGSIPCWIQVIGLFFIPESPRWLAK 207          
The following BLAST results are available for this feature:
BLAST of CF835377 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 188
Match NameE-valueIdentityDescription
ERDL6_ARATH3.923e-10079.57Sugar transporter ERD6-like 6 OS=Arabidopsis thali... [more]
ERDL4_ARATH8.179e-9877.92Sugar transporter ERD6-like 4 OS=Arabidopsis thali... [more]
ERDL7_ARATH1.848e-4952.33Sugar transporter ERD6-like 7 OS=Arabidopsis thali... [more]
EDL16_ARATH2.668e-4850.58Sugar transporter ERD6-like 16 OS=Arabidopsis thal... [more]
ERDL8_ARATH3.853e-4751.18Sugar transporter ERD6-like 8 OS=Arabidopsis thali... [more]
ERDL5_ARATH1.121e-4648.84Sugar transporter ERD6-like 5 OS=Arabidopsis thali... [more]
EDL14_ARATH1.790e-4448.84Sugar transporter ERD6-like 14 OS=Arabidopsis thal... [more]
ERDL3_ARATH3.987e-4448.84Sugar transporter ERD6-like 3 OS=Arabidopsis thali... [more]
EDL18_ARATH6.800e-4448.26Sugar transporter ERD6-like 18 OS=Arabidopsis thal... [more]
EDL12_ARATH1.160e-4351.19Sugar transporter ERD6-like 12 OS=Arabidopsis thal... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01C07_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01C07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835377 ID=CF835377|Name=CF835377|organism=Citrus sinensis|type=EST|length=771bp
ACGATCTCTTTGAAGCATTCCATCAAATCAATAATCATCCAAACACCAAC
ACCGTCTCCGTCGATCGTAAAGTAACGAGAGGCAATGAGTTTTAGAGACG
ATAATGAAGAAGCGGCTAATCTCCGTAAGCCGTTTCTCCACACGGGGAGT
TGGTACAAAATGGGCTCCAGACAGTCGAGTATCATGTCGTCATCGGCTCA
GATGCTTCGTGACGGCTCCGTCTCCGTTGTCTTTTGCGTCCTCGTCGTCG
CCCTCGGCCCCATCCAATTCGGTTTCACTTGTGGCTACTCTTCACCTACG
CAAGCCGAAATCATCAGCGATCTTAAACTTACAATTTCGGAGTTCTCTAT
ATTTGGCTCTTTAGCCAATGTGGGTGCTATGGTTGGTGCAATAGCTAGCG
GTCAGATAGCAGAGTACATTGGCCGAAAAGGGTCCCTAATGATTGCTGCT
GTTCCTAATATTATAGGATGGCTCATCATATCTTTCTCCAAAGATTCCTC
GTTTTTATTTATGGGAAGGTTGTTGGAAGGATTTGGTGTTGGTGTAATCT
CTTACACGGTGCCCGTGTACATAGCTGAGATAGCACCTCAAAATATGAGA
GGAAGTCTTGGATCTGTCAATCAGCTCTCAGTTACGATTGGAATTATGCT
GGCGTATCTATTGGGGCTTTTTGTCAATTGGAGAGTGCTTGCGGTTTTAG
GAGTTCTGCCATGTACATTGTTGATACCTGGATTGTTTTTCATACCAGAA
TCTCCTCGATGGCTGGCCAAA
back to top