CF835380

Overview
NameCF835380
Unique NameCF835380
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length594
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10926 contig Csv1_Contig10926:960..1553. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835380 vs. ExPASy Swiss-Prot
Match: NLTP_MALDO (Non-specific lipid-transfer protein OS=Malus domestica GN=MALD3 PE=1 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 1.221e-35
Identity = 71/114 (62.28%), Postives = 85/114 (74.56%), Query Frame = -2
Query:  228 AALKLVSALVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSADCYKVR 569
            A  KL   + LCM V+    A AITCGQV+ SLAPCIG++RSGG +P  CCNG+R++N  ARTT DRQTACNCLK  A SI  +N NNAAGLPG CGV++PYKISTS +C  V+
Sbjct:    5 AVTKLALVVALCMAVS---VAHAITCGQVTSSLAPCIGYVRSGGAVPPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVNVPYKISTSTNCATVK 115          
BLAST of CF835380 vs. ExPASy Swiss-Prot
Match: NLTP1_PRUDU (Non-specific lipid-transfer protein 1 OS=Prunus dulcis PE=3 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 1.221e-35
Identity = 69/114 (60.53%), Postives = 87/114 (76.32%), Query Frame = -2
Query:  228 AALKLVSALVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSADCYKVR 569
            A  KL   + LCM+V+ P+ AQAITCGQVS +LAPCI ++R GG +P  CCNG+R++N  ARTTPDRQ ACNCLKQ + S+P +N NNAA LPG CGV+IPY+IS S +C  V+
Sbjct:    5 AMTKLALVVALCMVVSVPI-AQAITCGQVSSNLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVNIPYQISPSTNCANVK 117          
BLAST of CF835380 vs. ExPASy Swiss-Prot
Match: NLTP_PRUAV (Non-specific lipid-transfer protein OS=Prunus avium PE=1 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 1.595e-35
Identity = 67/114 (58.77%), Postives = 87/114 (76.32%), Query Frame = -2
Query:  228 AALKLVSALVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSADCYKVR 569
            A  KL   + LCM+V+ P+ AQA+TCGQVS +LAPCI ++R GG +P  CCNG+R++N  A+TT DRQTACNCLKQ + S+P +N NNAA LPG CGV++PYKIS S +C  V+
Sbjct:    5 AMTKLALVVALCMVVSVPI-AQALTCGQVSSNLAPCIAYVRGGGAVPPACCNGIRNINNLAKTTADRQTACNCLKQLSASVPGVNANNAAALPGKCGVNVPYKISPSTNCATVK 117          
BLAST of CF835380 vs. ExPASy Swiss-Prot
Match: NLTP_HELAN (Non-specific lipid-transfer protein OS=Helianthus annuus PE=3 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 3.326e-33
Identity = 67/113 (59.29%), Postives = 83/113 (73.45%), Query Frame = -2
Query:  228 ALKLVSALVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSADCYKVR 566
            A+ ++ A V CM+V  P + +A++CGQVS SLAPCI +L  GG +P  CC+GV+SLN+AA+TTPDRQ AC CLK A  SI  +N  NAA  PG CGVSIPYKIS S DC KV+
Sbjct:    5 AMMVLCAGVTCMVVGAPYT-EALSCGQVSSSLAPCISYLTKGGAVPPACCSGVKSLNSAAKTTPDRQAACGCLKSAYNSISGVNAGNAASFPGKCGVSIPYKISPSTDCSKVQ 116          
BLAST of CF835380 vs. ExPASy Swiss-Prot
Match: LTP1_MORNI (Non-specific lipid-transfer protein 1 OS=Morus nigra PE=1 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 5.673e-33
Identity = 66/91 (72.53%), Postives = 72/91 (79.12%), Query Frame = -2
Query:  228 ITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSADCYKVR 500
            ITCGQVS SLAPCI +LR+GG +P  CCNGVRSLN AA+TT DRQ ACNCLK A  SI  LNLN AAGLPG CGVS+PYKIS S DC  V+
Sbjct:    1 ITCGQVSSSLAPCINYLRAGGVVPANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCGVSVPYKISPSTDCKSVK 91          
BLAST of CF835380 vs. ExPASy Swiss-Prot
Match: NLTP_SPIOL (Non-specific lipid-transfer protein OS=Spinacia oleracea PE=1 SV=2)

HSP 1 Score: 139.043 bits (349), Expect = 1.651e-32
Identity = 65/113 (57.52%), Postives = 81/113 (71.68%), Query Frame = -2
Query:  231 AALKLVSALVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSADCYKV 569
            A +KL  A++LC++V  P +   ITCG VS  LAPCIG+L+ GGP+   CC G+++LNAAA TTPDR+TACNCLK AA +I  +N   AAGLPG CGV IPY IS S +C  V
Sbjct:    5 AVIKLACAVLLCIVVAAPYAEAGITCGMVSSKLAPCIGYLK-GGPLGGGCCGGIKALNAAAATTPDRKTACNCLKSAANAIKGINYGKAAGLPGMCGVHIPYAISPSTNCNAV 116          
BLAST of CF835380 vs. ExPASy Swiss-Prot
Match: NLTP2_BRANA (Non-specific lipid-transfer protein 2 OS=Brassica napus GN=LTP2 PE=3 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 1.651e-32
Identity = 69/117 (58.97%), Postives = 84/117 (71.79%), Query Frame = -2
Query:  228 MAALKLVSALVL-CMLVTGPLSAQA-ITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSADCYKVR 572
            MA L  ++ LVL CM+V GP+++ A ++CG VSG +APCIG+L   GP+P  CC GV +LN  ARTTPDRQ AC CL  AA S P+LN   AAGLP ACGV+IPYKIS S +C  VR
Sbjct:    1 MAGLMKLACLVLACMIVAGPITSNAALSCGTVSGYVAPCIGYLTQNGPLPRGCCTGVTNLNNMARTTPDRQQACRCLVGAANSFPTLNAARAAGLPKACGVNIPYKISKSTNCNSVR 117          
BLAST of CF835380 vs. ExPASy Swiss-Prot
Match: NLTPB_BRAOT (Non-specific lipid-transfer protein B OS=Brassica oleracea var. italica GN=WAX9B PE=3 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 2.156e-32
Identity = 70/117 (59.83%), Postives = 83/117 (70.94%), Query Frame = -2
Query:  228 MAALKLVSALVL-CMLVTGPLSAQA-ITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSADCYKVR 572
            MA L  +S LVL CM+V GP++  A ++CG VSG+LA CIG+L   GP+P  CC GV +LN  ARTTPDRQ AC CL  AA S P+LN   AAGLP ACGV+IPYKIS S +C  VR
Sbjct:    1 MAGLVKLSCLVLACMIVAGPIATNAALSCGTVSGNLAACIGYLTQNGPLPRGCCTGVTNLNNMARTTPDRQQACRCLVGAANSFPTLNAARAAGLPKACGVNIPYKISKSTNCNSVR 117          
BLAST of CF835380 vs. ExPASy Swiss-Prot
Match: NLTP3_BRANA (Non-specific lipid-transfer protein 3 OS=Brassica napus GN=LTP3 PE=3 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 2.816e-32
Identity = 67/117 (57.26%), Postives = 86/117 (73.50%), Query Frame = -2
Query:  228 MAALKLVSALVL-CMLVTGPLSAQA-ITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSADCYKVR 572
            MA L  +S LVL CM+V GP++  A ++CG VSG+LA CIG+L   GP+P  CC+GV SLN  ARTTPDRQ AC CL  AA ++P++N+  AAGLP ACGV+IPYKIS + +C  V+
Sbjct:    1 MAGLVKLSCLVLACMIVAGPIATNAALSCGTVSGNLAACIGYLTQNGPVPTACCSGVTSLNNMARTTPDRQQACRCLVGAANALPTINVARAAGLPKACGVNIPYKISKTTNCNSVK 117          
BLAST of CF835380 vs. ExPASy Swiss-Prot
Match: NLTP_PYRCO (Non-specific lipid-transfer protein OS=Pyrus communis PE=1 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 3.677e-32
Identity = 63/114 (55.26%), Postives = 81/114 (71.05%), Query Frame = -2
Query:  228 AALKLVSALVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSADCYKVR 569
            A +KL   + LCM V+    A AITC QVS +LAPCI ++RSGG +P  CCNG++++N  A+TTPDRQ ACNCLK  A S+  +N  NA  LPG CGV++PYKISTS +C  V+
Sbjct:    5 AVIKLALVVALCMAVS---VAHAITCSQVSANLAPCINYVRSGGAVPPACCNGIKTINGLAKTTPDRQAACNCLKNLAGSVSGVNPGNAESLPGKCGVNVPYKISTSTNCATVK 115          
The following BLAST results are available for this feature:
BLAST of CF835380 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 77
Match NameE-valueIdentityDescription
NLTP_MALDO1.221e-3562.28Non-specific lipid-transfer protein OS=Malus domes... [more]
NLTP1_PRUDU1.221e-3560.53Non-specific lipid-transfer protein 1 OS=Prunus du... [more]
NLTP_PRUAV1.595e-3558.77Non-specific lipid-transfer protein OS=Prunus aviu... [more]
NLTP_HELAN3.326e-3359.29Non-specific lipid-transfer protein OS=Helianthus ... [more]
LTP1_MORNI5.673e-3372.53Non-specific lipid-transfer protein 1 OS=Morus nig... [more]
NLTP_SPIOL1.651e-3257.52Non-specific lipid-transfer protein OS=Spinacia ol... [more]
NLTP2_BRANA1.651e-3258.97Non-specific lipid-transfer protein 2 OS=Brassica ... [more]
NLTPB_BRAOT2.156e-3259.83Non-specific lipid-transfer protein B OS=Brassica ... [more]
NLTP3_BRANA2.816e-3257.26Non-specific lipid-transfer protein 3 OS=Brassica ... [more]
NLTP_PYRCO3.677e-3255.26Non-specific lipid-transfer protein OS=Pyrus commu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01C09_f Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01C09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835380 ID=CF835380|Name=CF835380|organism=Citrus sinensis|type=EST|length=594bp
TGAACAAAAGGCACCTTTTAAGGTAATAAAAAGAATAGACACAAACTGAC
GATGCCTTGAAAAGCAAAGACAATAAAACATAACATGAAACGAGGGCGCG
AACGAGACTCGCAGTACAAAGTGTACAGAGAGACTCATAAATCGGACACA
AAAATGTCCTTATTATTATACATTTATTCTACTCCGTCAACTTAAACCTG
AAAATCAACGGCCCAGATTCCTGTTCACCTGACCTTATAGCAGTCAGCGG
AGGTGCTGATCTTGTAAGGAATGCTGACTCCACAAGCTCCTGGAAGACCA
GCAGCATTATTAAGGTTGAGGCTAGGGATTGATCTGGCGGCTTGCTTCAA
GCAGTTGCATGCAGTTTGGCGGTCAGGTGTGGTTCTGGCGGCAGCGTTGA
GAGACCTGACGCCGTTGCAGCATGGCATAGGTATAGGGCCGCCCGATCTC
AAGAAACCGATGCATGGTGCCAATGAGCCACTCACCTGCCCACATGTTAT
GGCCTGAGCACTCAGGGGACCAGTCACCAACATGCACAGAACCAAAGCTG
AAACAAGCTTGAGGGCAGCCATTTGAGATTTCTCCTGAGATTTT
back to top