CF835381

Overview
NameCF835381
Unique NameCF835381
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length623
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10926 contig Csv1_Contig10926:959..1581. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835381 vs. ExPASy Swiss-Prot
Match: NLTP_MALDO (Non-specific lipid-transfer protein OS=Malus domestica GN=MALD3 PE=1 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 7.877e-36
Identity = 71/114 (62.28%), Postives = 86/114 (75.44%), Query Frame = 3
Query:   27 AALKLVSALLLCMLVTGPLSAQAITCGQVSGSLPPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 368
            A  KL   + LCM V+    A AITCGQV+ SL PCIG++RSGG +P  CCNG+R++N  ARTT DRQTACNCLK  A SI  +N NNAAGLPG CGV++PYKISTST+C+ V+
Sbjct:    5 AVTKLALVVALCMAVS---VAHAITCGQVTSSLAPCIGYVRSGGAVPPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVNVPYKISTSTNCATVK 115          
BLAST of CF835381 vs. ExPASy Swiss-Prot
Match: NLTP1_PRUDU (Non-specific lipid-transfer protein 1 OS=Prunus dulcis PE=3 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 7.877e-36
Identity = 69/114 (60.53%), Postives = 88/114 (77.19%), Query Frame = 3
Query:   27 AALKLVSALLLCMLVTGPLSAQAITCGQVSGSLPPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 368
            A  KL   + LCM+V+ P+ AQAITCGQVS +L PCI ++R GG +P  CCNG+R++N  ARTTPDRQ ACNCLKQ + S+P +N NNAA LPG CGV+IPY+IS ST+C+ V+
Sbjct:    5 AMTKLALVVALCMVVSVPI-AQAITCGQVSSNLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVNIPYQISPSTNCANVK 117          
BLAST of CF835381 vs. ExPASy Swiss-Prot
Match: NLTP_PRUAV (Non-specific lipid-transfer protein OS=Prunus avium PE=1 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 1.029e-35
Identity = 67/114 (58.77%), Postives = 88/114 (77.19%), Query Frame = 3
Query:   27 AALKLVSALLLCMLVTGPLSAQAITCGQVSGSLPPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 368
            A  KL   + LCM+V+ P+ AQA+TCGQVS +L PCI ++R GG +P  CCNG+R++N  A+TT DRQTACNCLKQ + S+P +N NNAA LPG CGV++PYKIS ST+C+ V+
Sbjct:    5 AMTKLALVVALCMVVSVPI-AQALTCGQVSSNLAPCIAYVRGGGAVPPACCNGIRNINNLAKTTADRQTACNCLKQLSASVPGVNANNAAALPGKCGVNVPYKISPSTNCATVK 117          
BLAST of CF835381 vs. ExPASy Swiss-Prot
Match: NLTP_HELAN (Non-specific lipid-transfer protein OS=Helianthus annuus PE=3 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 1.642e-33
Identity = 67/113 (59.29%), Postives = 84/113 (74.34%), Query Frame = 3
Query:   30 ALKLVSALLLCMLVTGPLSAQAITCGQVSGSLPPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 368
            A+ ++ A + CM+V  P + +A++CGQVS SL PCI +L  GG +P  CC+GV+SLN+AA+TTPDRQ AC CLK A  SI  +N  NAA  PG CGVSIPYKIS STDCSKV+
Sbjct:    5 AMMVLCAGVTCMVVGAPYT-EALSCGQVSSSLAPCISYLTKGGAVPPACCSGVKSLNSAAKTTPDRQAACGCLKSAYNSISGVNAGNAASFPGKCGVSIPYKISPSTDCSKVQ 116          
BLAST of CF835381 vs. ExPASy Swiss-Prot
Match: NLTP_SPIOL (Non-specific lipid-transfer protein OS=Spinacia oleracea PE=1 SV=2)

HSP 1 Score: 141.354 bits (355), Expect = 3.659e-33
Identity = 66/113 (58.41%), Postives = 82/113 (72.57%), Query Frame = 3
Query:   27 AALKLVSALLLCMLVTGPLSAQAITCGQVSGSLPPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKV 365
            A +KL  A+LLC++V  P +   ITCG VS  L PCIG+L+ GGP+   CC G+++LNAAA TTPDR+TACNCLK AA +I  +N   AAGLPG CGV IPY IS ST+C+ V
Sbjct:    5 AVIKLACAVLLCIVVAAPYAEAGITCGMVSSKLAPCIGYLK-GGPLGGGCCGGIKALNAAAATTPDRKTACNCLKSAANAIKGINYGKAAGLPGMCGVHIPYAISPSTNCNAV 116          
BLAST of CF835381 vs. ExPASy Swiss-Prot
Match: LTP1_MORNI (Non-specific lipid-transfer protein 1 OS=Morus nigra PE=1 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 3.659e-33
Identity = 66/91 (72.53%), Postives = 72/91 (79.12%), Query Frame = 3
Query:   96 ITCGQVSGSLPPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 368
            ITCGQVS SL PCI +LR+GG +P  CCNGVRSLN AA+TT DRQ ACNCLK A  SI  LNLN AAGLPG CGVS+PYKIS STDC  V+
Sbjct:    1 ITCGQVSSSLAPCINYLRAGGVVPANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCGVSVPYKISPSTDCKSVK 91          
BLAST of CF835381 vs. ExPASy Swiss-Prot
Match: NLTP2_BRANA (Non-specific lipid-transfer protein 2 OS=Brassica napus GN=LTP2 PE=3 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 6.241e-33
Identity = 66/113 (58.41%), Postives = 82/113 (72.57%), Query Frame = 3
Query:   33 LKLVSALLLCMLVTGPLSAQA-ITCGQVSGSLPPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 368
            +KL   +L CM+V GP+++ A ++CG VSG + PCIG+L   GP+P  CC GV +LN  ARTTPDRQ AC CL  AA S P+LN   AAGLP ACGV+IPYKIS ST+C+ VR
Sbjct:    5 MKLACLVLACMIVAGPITSNAALSCGTVSGYVAPCIGYLTQNGPLPRGCCTGVTNLNNMARTTPDRQQACRCLVGAANSFPTLNAARAAGLPKACGVNIPYKISKSTNCNSVR 117          
BLAST of CF835381 vs. ExPASy Swiss-Prot
Match: NLTP_CICAR (Non-specific lipid-transfer protein OS=Cicer arietinum PE=3 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 8.151e-33
Identity = 66/115 (57.39%), Postives = 84/115 (73.04%), Query Frame = 3
Query:   24 MAALKLVSALLLCMLVTGPLSAQAITCGQVSGSLPPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 368
            MA++K+V   L+  +V  P++  AITCG+V  +L PC+G+L+ G      CC GVR+LN+AA TTPDRQ ACNCLK AA SI  LN NNAA LPG C V+IPYKISTST+C+ +R
Sbjct:    1 MASMKVVCVALIMCIVIAPMAESAITCGRVDTALAPCLGYLQGGPGPSAQCCGGVRNLNSAAVTTPDRQAACNCLKSAAGSISRLNANNAAALPGKCVVNIPYKISTSTNCATIR 115          
BLAST of CF835381 vs. ExPASy Swiss-Prot
Match: NLTP_PYRCO (Non-specific lipid-transfer protein OS=Pyrus communis PE=1 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 2.372e-32
Identity = 63/114 (55.26%), Postives = 82/114 (71.93%), Query Frame = 3
Query:   27 AALKLVSALLLCMLVTGPLSAQAITCGQVSGSLPPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 368
            A +KL   + LCM V+    A AITC QVS +L PCI ++RSGG +P  CCNG++++N  A+TTPDRQ ACNCLK  A S+  +N  NA  LPG CGV++PYKISTST+C+ V+
Sbjct:    5 AVIKLALVVALCMAVS---VAHAITCSQVSANLAPCINYVRSGGAVPPACCNGIKTINGLAKTTPDRQAACNCLKNLAGSVSGVNPGNAESLPGKCGVNVPYKISTSTNCATVK 115          
BLAST of CF835381 vs. ExPASy Swiss-Prot
Match: NLTPB_BRAOT (Non-specific lipid-transfer protein B OS=Brassica oleracea var. italica GN=WAX9B PE=3 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 2.372e-32
Identity = 69/117 (58.97%), Postives = 84/117 (71.79%), Query Frame = 3
Query:   24 MAALKLVSALLL-CMLVTGPLSAQA-ITCGQVSGSLPPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 368
            MA L  +S L+L CM+V GP++  A ++CG VSG+L  CIG+L   GP+P  CC GV +LN  ARTTPDRQ AC CL  AA S P+LN   AAGLP ACGV+IPYKIS ST+C+ VR
Sbjct:    1 MAGLVKLSCLVLACMIVAGPIATNAALSCGTVSGNLAACIGYLTQNGPLPRGCCTGVTNLNNMARTTPDRQQACRCLVGAANSFPTLNAARAAGLPKACGVNIPYKISKSTNCNSVR 117          
The following BLAST results are available for this feature:
BLAST of CF835381 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 77
Match NameE-valueIdentityDescription
NLTP_MALDO7.877e-3662.28Non-specific lipid-transfer protein OS=Malus domes... [more]
NLTP1_PRUDU7.877e-3660.53Non-specific lipid-transfer protein 1 OS=Prunus du... [more]
NLTP_PRUAV1.029e-3558.77Non-specific lipid-transfer protein OS=Prunus aviu... [more]
NLTP_HELAN1.642e-3359.29Non-specific lipid-transfer protein OS=Helianthus ... [more]
NLTP_SPIOL3.659e-3358.41Non-specific lipid-transfer protein OS=Spinacia ol... [more]
LTP1_MORNI3.659e-3372.53Non-specific lipid-transfer protein 1 OS=Morus nig... [more]
NLTP2_BRANA6.241e-3358.41Non-specific lipid-transfer protein 2 OS=Brassica ... [more]
NLTP_CICAR8.151e-3357.39Non-specific lipid-transfer protein OS=Cicer ariet... [more]
NLTP_PYRCO2.372e-3255.26Non-specific lipid-transfer protein OS=Pyrus commu... [more]
NLTPB_BRAOT2.372e-3258.97Non-specific lipid-transfer protein B OS=Brassica ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01C09_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01C09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835381 ID=CF835381|Name=CF835381|organism=Citrus sinensis|type=EST|length=623bp
GAAAATCTCAGCAGTAATCTCAAATGGCTGCCCTCAAGCTTGTTTCAGCT
TTGCTTCTGTGCATGTTGGTGACTGGTCCCCTGAGTGCTCAGGCCATAAC
ATGTGGGCAGGTGAGTGGCTCATTGCCACCATGCATCGGTTTCTTGAGAT
CGGGCGGCCCTATACCTATGCCATGCTGCAACGGCGTCAGGTCTCTCAAC
GCTGCCGCCAGAACCACACCTGACCGCCAAACTGCATGCAACTGCTTGAA
GCAAGCCGCCAGATCAATCCCTAGCCTCAACCTTAATAATGCTGCTGGTC
TTCCAGGAGCTTGTGGAGTCAGCATTCCTTACAAGATCAGCACCTCCACT
GACTGCTCTAAGGTCAGGTGAACAGGAATCTGGGCCGTTGATTTTCAGGT
TTAAGTTGACGGAGTAGAATAAATGTATAATAATAAGGACATTTTTGTGT
CCGATTTATGAGTCTCTCTCTACACTTTGTACTGCGAGTCTCGTTCGCGC
CCTCGTTTCATGTTATGTTTTATTGTCTTTGCTTTTCATGTCATCGTCAG
TTTGTGTCTATTCTGTTTATTAAATGAAATCTTGCCTTGTGTTCAGTTTA
ACAACTTAAAAAAAAAAAAAAAA
back to top