CF835589

Overview
NameCF835589
Unique NameCF835589
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length757
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CF835589_ssr705 microsatellite CF835589_ssr705:705..716. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig1116 contig Csv1_Contig1116:3..759. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835589 vs. ExPASy Swiss-Prot
Match: RPB4_MOUSE (DNA-directed RNA polymerase II subunit RPB4 OS=Mus musculus GN=Polr2d PE=2 SV=2)

HSP 1 Score: 91.6633 bits (226), Expect = 4.789e-18
Identity = 53/168 (31.55%), Postives = 92/168 (54.76%), Query Frame = -1
Query:  218 SGEEEENAAELKIGDEFLKAKCLMNCEVAIILHHKYEQLQQTSDDPMNQVSQVFEKSLQYVKRFSRYKNPDAVRQVREILSRYQLAEFEVNCPGLAKLGFLYLLSPLRKIKLESHSPLLQLCVLGNLCPETVEEAIAMVPSIKTRGRAHDDEAIEKMLNDLSLIKKFE 721
            +G+ EE+A++L    EF  A+ L+N EV ++L H+ +Q +   D+   ++S+VF K+L Y  RFSR+KN + +  VR +L + +L +FE+ C                               L NLCPET EE+ A++PS++ R    +DE ++++L+D+   + F+
Sbjct:   10 AGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDE--QELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELAC-------------------------------LANLCPETAEESKALIPSLEGR---FEDEELQQILDDIQTKRSFQ 141          
BLAST of CF835589 vs. ExPASy Swiss-Prot
Match: RPB4_HUMAN (DNA-directed RNA polymerase II subunit RPB4 OS=Homo sapiens GN=POLR2D PE=1 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 4.789e-18
Identity = 53/168 (31.55%), Postives = 92/168 (54.76%), Query Frame = -1
Query:  218 SGEEEENAAELKIGDEFLKAKCLMNCEVAIILHHKYEQLQQTSDDPMNQVSQVFEKSLQYVKRFSRYKNPDAVRQVREILSRYQLAEFEVNCPGLAKLGFLYLLSPLRKIKLESHSPLLQLCVLGNLCPETVEEAIAMVPSIKTRGRAHDDEAIEKMLNDLSLIKKFE 721
            +G+ EE+A++L    EF  A+ L+N EV ++L H+ +Q +   D+   ++S+VF K+L Y  RFSR+KN + +  VR +L + +L +FE+ C                               L NLCPET EE+ A++PS++ R    +DE ++++L+D+   + F+
Sbjct:   10 AGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDE--QELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELAC-------------------------------LANLCPETAEESKALIPSLEGR---FEDEELQQILDDIQTKRSFQ 141          
BLAST of CF835589 vs. ExPASy Swiss-Prot
Match: RPB4_DICDI (DNA-directed RNA polymerase II subunit rpb4 OS=Dictyostelium discoideum GN=polr2d PE=3 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 2.906e-15
Identity = 55/188 (29.26%), Postives = 88/188 (46.81%), Query Frame = -1
Query:  221 TKPRALRMSGEEEENAAELKIGDEFLKAKCLMNCEVAIILHHKYEQLQQTSDD-------------PMNQVSQVFEKSLQYVKRFSRYKNPDAVRQVREILSRYQLAEFEVNCPGLAKLGFLYLLSPLRKIKLESHSPLLQLCVLGNLCPETVEEAIAMVPSIKTRGRAHDDEAIEKMLNDLSLIKKF 745
            T P   R   +EEE+   LK   +   AK L+N EVAI+L H+    +    +              +N + + F K+L Y ++FSRYKN  +++QVR  LS+  L EFE+                                 L NLCPE  +EA +++PS+K      +D+ ++ +L++LS ++KF
Sbjct:    2 TDPLIKRSGIQEEEDLTTLKFPRDLKDAKFLLNSEVAILLEHRKGISESEGTEFPQNTLLIHLYYNSINDIIRTFHKTLAYAEKFSRYKNKTSIKQVRTALSKQNLEEFEI-------------------------------ASLANLCPEISDEAKSLIPSLKKM----EDDELQAILDELSNLRKF 154          
BLAST of CF835589 vs. ExPASy Swiss-Prot
Match: RPB4_DROME (DNA-directed RNA polymerase II 16 kDa polypeptide OS=Drosophila melanogaster GN=Rpb4 PE=1 SV=5)

HSP 1 Score: 72.4034 bits (176), Expect = 3.007e-12
Identity = 47/157 (29.94%), Postives = 78/157 (49.68%), Query Frame = -1
Query:  239 EENAAELKIGDEFLKAKCLMNCEVAIILHHKYEQLQQTSDDPMNQVSQVFEKSLQYVKRFSRYKNPDAVRQVREILSRYQLAEFEVNCPGLAKLGFLYLLSPLRKIKLESHSPLLQLCVLGNLCPETVEEAIAMVPSIKTRGRAHDDEAIEKMLNDL 709
            +E+AA+L+   EF  A+ L+  EV ++L H+  + Q  S D   + S+VF K+  Y   F ++KN + +   R +L + +L +FE                               L  LGNLCPE  EEA A++PS++ R    +DE + ++L+D+
Sbjct:   11 DEDAADLQFPKEFENAETLLISEVHMLLDHR--KRQNESADEEQEFSEVFMKTYAYTDSFRKFKNKETIMSARSLLMQKKLHKFE-------------------------------LAALGNLCPEAPEEAKALIPSLEGR---FEDEELRQILDDI 131          
The following BLAST results are available for this feature:
BLAST of CF835589 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
RPB4_MOUSE4.789e-1831.55DNA-directed RNA polymerase II subunit RPB4 OS=Mus... [more]
RPB4_HUMAN4.789e-1831.55DNA-directed RNA polymerase II subunit RPB4 OS=Hom... [more]
RPB4_DICDI2.906e-1529.26DNA-directed RNA polymerase II subunit rpb4 OS=Dic... [more]
RPB4_DROME3.007e-1229.94DNA-directed RNA polymerase II 16 kDa polypeptide ... [more]
back to top
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS03_01I11_f Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01I11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835589 ID=CF835589|Name=CF835589|organism=Citrus sinensis|type=EST|length=757bp
TTTTTTTTTTTTTTTGATTGGAACTCTTTTACTTGAATTTGACCGTAAAC
TCATTTCAACAAGATATTCTAAATATCTGGTTCCTTCAAGATCCTCGTAA
TATCTGACCAATAAAGTAAATAGATTCTCTCTCACATTCAAACTTTATAC
ATTACAATACCTAATGCATTTTTTTTTATCCCTAAGAAACTTCAATAGGT
AGCTCCAGCTGTAATTACTCAAATTTCTTTATCAGTGACAAGTCATTCAA
CATTTTCTCAATTGCCTCGTCATCGTGAGCTCGTCCCCTAGTCTTTATCG
AAGGTACCATAGCAATGGCTTCCTCCACAGTCTCAGGGCAAAGATTTCCA
AGTACACACAGCTGCAAAAGGGGAGAGTGTGACTCCAATTTAATTTTTCT
AAGGGGAGATAATAAATATAGAAATCCTAATTTAGCAAGTCCAGGGCAAT
TTACCTCGAATTCAGCCAACTGGTATCTACTAAGGATTTCTCGCACTTGT
CTAACAGCATCAGGATTCTTGTAGCGACTAAAGCGCTTCACATACTGCAG
TGATTTCTCAAACACTTGGGAAACTTGATTCATGGGATCATCAGAAGTCT
GCTGAAGCTGCTCATACTTGTGATGAAGAATTATTGCTACTTCACAATTC
ATCAAACACTTGGCCTTCAAAAACTCGTCTCCAATTTTAAGCTCGGCCGC
GTTCTCTTCTTCTTCTCCAGACATTCTCAAAGCTCTTGGCTTTGTTTTTC
AAAATTC
back to top