CF835593

Overview
NameCF835593
Unique NameCF835593
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length708
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13665 contig Csv1_Contig13665:206..887. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835593 vs. ExPASy Swiss-Prot
Match: ARF2_ORYSJ (ADP-ribosylation factor 2 OS=Oryza sativa subsp. japonica GN=ARF PE=2 SV=2)

HSP 1 Score: 289.656 bits (740), Expect = 1.073e-77
Identity = 139/141 (98.58%), Postives = 141/141 (100.00%), Query Frame = -1
Query:  286 EIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA 708
            EIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+R+VEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct:   41 EIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA 181          
BLAST of CF835593 vs. ExPASy Swiss-Prot
Match: ARF1_ARATH (ADP-ribosylation factor 1 OS=Arabidopsis thaliana GN=ARF1 PE=1 SV=2)

HSP 1 Score: 289.271 bits (739), Expect = 1.401e-77
Identity = 139/141 (98.58%), Postives = 141/141 (100.00%), Query Frame = -1
Query:  286 EIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA 708
            EIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+KA
Sbjct:   41 EIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA 181          
BLAST of CF835593 vs. ExPASy Swiss-Prot
Match: ARF2_ARATH (ADP-ribosylation factor 2 OS=Arabidopsis thaliana GN=ARF2-A PE=2 SV=3)

HSP 1 Score: 288.886 bits (738), Expect = 1.830e-77
Identity = 139/141 (98.58%), Postives = 140/141 (99.29%), Query Frame = -1
Query:  286 EIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA 708
            EIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA KA
Sbjct:   41 EIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIAGKA 181          
BLAST of CF835593 vs. ExPASy Swiss-Prot
Match: ARF_VIGUN (ADP-ribosylation factor OS=Vigna unguiculata GN=ARF PE=2 SV=3)

HSP 1 Score: 287.73 bits (735), Expect = 4.076e-77
Identity = 138/141 (97.87%), Postives = 141/141 (100.00%), Query Frame = -1
Query:  286 EIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA 708
            EIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGL+WLSNNIA+KA
Sbjct:   41 EIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLEWLSNNIASKA 181          
BLAST of CF835593 vs. ExPASy Swiss-Prot
Match: ARF1_ORYSJ (ADP-ribosylation factor 1 OS=Oryza sativa subsp. japonica GN=Os01g0813400 PE=2 SV=3)

HSP 1 Score: 287.73 bits (735), Expect = 4.076e-77
Identity = 138/141 (97.87%), Postives = 141/141 (100.00%), Query Frame = -1
Query:  286 EIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA 708
            EIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+R+VEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+KA
Sbjct:   41 EIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA 181          
BLAST of CF835593 vs. ExPASy Swiss-Prot
Match: ARF1_CHLRE (ADP-ribosylation factor 1 OS=Chlamydomonas reinhardtii GN=ARF1 PE=2 SV=2)

HSP 1 Score: 287.345 bits (734), Expect = 5.323e-77
Identity = 137/140 (97.86%), Postives = 140/140 (100.00%), Query Frame = -1
Query:  289 EIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 708
            EIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+R+VEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNN+ANK
Sbjct:   41 EIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNLANK 180          
BLAST of CF835593 vs. ExPASy Swiss-Prot
Match: ARF1_DAUCA (ADP-ribosylation factor 1 OS=Daucus carota GN=ARF1 PE=2 SV=2)

HSP 1 Score: 285.804 bits (730), Expect = 1.549e-76
Identity = 137/141 (97.16%), Postives = 140/141 (99.29%), Query Frame = -1
Query:  286 EIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA 708
            EIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEI DKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA+K+
Sbjct:   41 EIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEIIDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKS 181          
BLAST of CF835593 vs. ExPASy Swiss-Prot
Match: ARF1_SALBA (ADP-ribosylation factor 1 OS=Salix bakko GN=ARF1 PE=2 SV=3)

HSP 1 Score: 285.419 bits (729), Expect = 2.023e-76
Identity = 137/141 (97.16%), Postives = 140/141 (99.29%), Query Frame = -1
Query:  286 EIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA 708
            EIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+ EARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI++KA
Sbjct:   41 EIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVGEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNISSKA 181          
BLAST of CF835593 vs. ExPASy Swiss-Prot
Match: ARF1_CATRO (ADP-ribosylation factor 1 OS=Catharanthus roseus GN=ARF1 PE=2 SV=3)

HSP 1 Score: 283.878 bits (725), Expect = 5.885e-76
Identity = 137/141 (97.16%), Postives = 139/141 (98.58%), Query Frame = -1
Query:  286 EIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA 708
            EIVTTIPTIGFNVETVEY+ ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDK GLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA
Sbjct:   41 EIVTTIPTIGFNVETVEYQYISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKHGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA 181          
BLAST of CF835593 vs. ExPASy Swiss-Prot
Match: ARF_MAIZE (ADP-ribosylation factor OS=Zea mays GN=ARF1 PE=2 SV=2)

HSP 1 Score: 281.952 bits (720), Expect = 2.236e-75
Identity = 135/141 (95.74%), Postives = 140/141 (99.29%), Query Frame = -1
Query:  286 EIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA 708
            EIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGL+SLRQRHWYIQSTCAT+GEGLYEGLDWLS+NIA K+
Sbjct:   41 EIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLNSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIATKS 181          
The following BLAST results are available for this feature:
BLAST of CF835593 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 209
Match NameE-valueIdentityDescription
ARF2_ORYSJ1.073e-7798.58ADP-ribosylation factor 2 OS=Oryza sativa subsp. j... [more]
ARF1_ARATH1.401e-7798.58ADP-ribosylation factor 1 OS=Arabidopsis thaliana ... [more]
ARF2_ARATH1.830e-7798.58ADP-ribosylation factor 2 OS=Arabidopsis thaliana ... [more]
ARF_VIGUN4.076e-7797.87ADP-ribosylation factor OS=Vigna unguiculata GN=AR... [more]
ARF1_ORYSJ4.076e-7797.87ADP-ribosylation factor 1 OS=Oryza sativa subsp. j... [more]
ARF1_CHLRE5.323e-7797.86ADP-ribosylation factor 1 OS=Chlamydomonas reinhar... [more]
ARF1_DAUCA1.549e-7697.16ADP-ribosylation factor 1 OS=Daucus carota GN=ARF1... [more]
ARF1_SALBA2.023e-7697.16ADP-ribosylation factor 1 OS=Salix bakko GN=ARF1 P... [more]
ARF1_CATRO5.885e-7697.16ADP-ribosylation factor 1 OS=Catharanthus roseus G... [more]
ARF_MAIZE2.236e-7595.74ADP-ribosylation factor OS=Zea mays GN=ARF1 PE=2 S... [more]

Pages

back to top
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS03_01I14_f Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01I14, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835593 ID=CF835593|Name=CF835593|organism=Citrus sinensis|type=EST|length=708bp
GGGGGCGGGCCCCTTTTTTTACGCAATGCGAAAAAAACAATTTCAAATAT
GAGTGGTGCACCCCATTAGTTTCAATTACAGATATCTAAACCGAGCCAAA
AACCTTGGAGTACATGTATCCAACCAACAATTCTTCTATTACAATATAGT
TGTAAAGATCCTAGGACCAAAACAACACAACAACCCAAACGTCTCAAACA
AAAAGGGTTAAAAAGAAAAAAAAATAGATAATATTCACCCCTGCATCCAG
AATTGCCAGTCCGCAAAAAGATCTTAACAGCTTCAGGCCTTGTTAGCGAT
GTTGTTGGAGAGCCAATCCAGACCTTCATAAAGACCCTCACCAGAGGTTG
CACAGGTGCTCTGGATGTACCAGTGGCGCTGCCTGAGGGAGTGGAGGCCA
AGCTTATCAGTAATCTCAGCAGCATTCATTGCATTTGGAAGATCCTGTTT
GTTAGCAAATACAAGCAACACTGCATCTCGCAGCTCATCCTCATTCAACA
TCCTATGCAATTCATCCCTTGCTTCTACAATACGGTCTCTGTCATTGCTG
TCCACAACAAAAATGAGACCTTGAGTGTTCTGGAAATAATGCCTCCACAA
GGGACGAATCTTGTCCTGGCCACCAACATCCCACACAGTGAAACTGATGT
TTTTATATTCAACGGTCTCCACATTAAACCCAATGGTAGGAATTGTGGTG
ACAATCTC
back to top