CF835597

Overview
NameCF835597
Unique NameCF835597
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length801
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF835597 vs. ExPASy Swiss-Prot
Match: PTR5_ARATH (Peptide transporter PTR5 OS=Arabidopsis thaliana GN=PTR5 PE=2 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 1.009e-45
Identity = 88/214 (41.12%), Postives = 131/214 (61.21%), Query Frame = -2
Query:  174 GTFTVSQAMKMNRHLGPKFQIPPGTVGVISMITIGLWLPFYDTVLVPALRKITKHEGGITLLQRIGIGMIFSILSMIVAGLVERGRRASAHLHPMSQ-----VSVFWLAPQLILMGFCEAFNIIGQIEFFNKQFPDHMRSIANSLLFCSFGFASYLSSLLITIVHGVTARHGHPDWLTNDIDAGRLDYFYFLIAGLGGLNIVYFLYCARRYRYK 800
            GT  V Q   +++H+GP F+IP  ++ +   +++  W P YD ++VP  RK T HE G T LQRIGIG++ SI SM+ AG++E  R      H +       +++FW  PQ  L+G  E F  IGQ+EFF  Q PD MRS+ ++L   +  F +YLS+ L+T+V  VT   G P W+  +++ G LDYF++L+AGL  LN + +L+ A+ Y YK
Sbjct:  350 GTVFVLQGNTLDQHMGPNFKIPSASLSLFDTLSVLFWAPVYDKLIVPFARKYTGHERGFTQLQRIGIGLVISIFSMVSAGILEVARLNYVQTHNLYNEETIPMTIFWQVPQYFLVGCAEVFTFIGQLEFFYDQAPDAMRSLCSALSLTAIAFGNYLSTFLVTLVTKVTRSGGRPGWIAKNLNNGHLDYFFWLLAGLSFLNFLVYLWIAKWYTYK 563          
BLAST of CF835597 vs. ExPASy Swiss-Prot
Match: PTR1_ARATH (Peptide transporter PTR1 OS=Arabidopsis thaliana GN=PTR1 PE=2 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 3.246e-44
Identity = 82/216 (37.96%), Postives = 134/216 (62.04%), Query Frame = -2
Query:  165 TFTVSQAMKMNRHLGPKFQIPPGTVGVISMITIGLWLPFYDTVLVPALRKITKHEGGITLLQRIGIGMIFSILSMIVAGLVERGRRASAHLH-----PMSQVSVFWLAPQLILMGFCEAFNIIGQIEFFNKQFPDHMRSIANSLLFCSFGFASYLSSLLITIVHGVTARHGHPDWLTNDIDAGRLDYFYFLIAGLGGLNIVYFLYCARRYRYKSGI 797
            T  V Q   M++H+G  F+IP  ++ +   +++  W P YD  ++P  RK T++E G T LQR+GIG++ SI +MI AG++E  R      H         +S+FW  PQ +L+G  E F  IGQ+EFF  Q PD MRS+ ++L   +    +YLS++L+T+V  +T ++G P W+ ++++ G LDYF++L+A L  LN + +L+ ++RY+YK  +
Sbjct:  351 TMFVLQGNTMDQHMGKNFEIPSASLSLFDTVSVLFWTPVYDQFIIPLARKFTRNERGFTQLQRMGIGLVVSIFAMITAGVLEVVRLDYVKTHNAYDQKQIHMSIFWQIPQYLLIGCAEVFTFIGQLEFFYDQAPDAMRSLCSALSLTTVALGNYLSTVLVTVVMKITKKNGKPGWIPDNLNRGHLDYFFYLLATLSFLNFLVYLWISKRYKYKKAV 566          
BLAST of CF835597 vs. ExPASy Swiss-Prot
Match: PTR2_ARATH (Peptide transporter PTR2 OS=Arabidopsis thaliana GN=PTR2 PE=1 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 4.540e-38
Identity = 81/214 (37.85%), Postives = 126/214 (58.88%), Query Frame = -2
Query:  174 TFTVSQAMKMNRHLGPKFQIPPGTVGVISMITIGLWLPFYDTVLVPALRKITKHEGGITLLQRIGIGMIFSILSMIVAGLVERGRRASAHLHPMSQ------VSVFWLAPQLILMGFCEAFNIIGQIEFFNKQFPDHMRSIANSLLFCSFGFASYLSSLLITIVHGVTARHGHPDWLTNDIDAGRLDYFYFLIAGLGGLNIVYFLYCARRYRYK 797
            T  V Q   MN  +G  FQ+PP  +G     ++ +W+P YD  +VP  RK T  + G T +QR+GIG+  S+L M  A +VE  R   A+   + +      +SV W  PQ  ++G  E F  IGQ+EFF  Q PD MRS+ ++L   +    +YLSSL++T+V   T R+G   W+++++++G LDYF++L+AGL  +N+  + + A RY+ K
Sbjct:  369 TMFVQQGRAMNCKIG-SFQLPPAALGTFDTASVIIWVPLYDRFIVPLARKFTGVDKGFTEIQRMGIGLFVSVLCMAAAAIVEIIRLHMANDLGLVESGAPVPISVLWQIPQYFILGAAEVFYFIGQLEFFYDQSPDAMRSLCSALALLTNALGNYLSSLILTLVTYFTTRNGQEGWISDNLNSGHLDYFFWLLAGLSLVNMAVYFFSAARYKQK 581          
BLAST of CF835597 vs. ExPASy Swiss-Prot
Match: PTR2X_ARATH (Probable peptide transporter At1g52190 OS=Arabidopsis thaliana GN=At1g52190 PE=1 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 6.784e-34
Identity = 72/215 (33.49%), Postives = 125/215 (58.14%), Query Frame = -2
Query:  183 TFTVSQAMKMNRHL---GPKFQIPPGTVGVISMITIGLWLPFYDTVLVPALRKITKHEGGITLLQRIGIGMIFSILSMIVAGLVERGRRASA-------HLHPMSQVSVFWLAPQLILMGFCEAFNIIGQIEFFNKQFPDHMRSIANSLLFCSFGFASYLSSLLITIVHGVTARHGHPDWLTNDIDAGRLDYFYFLIAGLGGLNIVYFLYCARRY 797
            +F + QA  M+R L   G  FQ+P G+ G+ ++I + LW+  YD  ++P   KI      +++  R+G+G+  S L+M ++ +VE  RR  A       + + +  +S  WL PQ +L G  EA   IGQ EFF  +FP  M SIA SL       AS L+S+++  V+ +T+R+G   W++++I+ G  +Y+Y+++A +  +N++Y++ C+  Y
Sbjct:  352 SFQLLQATSMDRRLSRHGSSFQVPAGSFGMFTIIALALWVILYDRAVIPLASKIRGRPFRLSVKLRMGLGLFMSFLAMAISAMVESFRRKKAISQGYANNSNAVVDISAMWLVPQYVLHGLAEALTAIGQTEFFYTEFPKSMSSIAASLFGLGMAVASLLASVVLNAVNELTSRNGKESWVSDNINKGHYNYYYWVLAIMSFINVIYYVICSWSY 566          
BLAST of CF835597 vs. ExPASy Swiss-Prot
Match: PTR3B_ARATH (Peptide transporter PTR3-B OS=Arabidopsis thaliana GN=PTR3-B PE=2 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 4.862e-32
Identity = 80/229 (34.93%), Postives = 127/229 (55.46%), Query Frame = -2
Query:  141 TFTVSQAMKMNRHLGPKFQIPPGTVGVISMITIGLWLPFYDTVLVPALRKITKHEGGITLLQRIGIGMIFSILSMIVAGLVERGRRASAHLHPMSQ-------VSVFWLAPQLILMGFCEAFNIIGQIEFFNKQFPDHMRSIANSLLFCSFGFASYLSSLLITIVHGVTARHGHPDWLTNDIDAGRLDYFYFLIAGLGGLNIVYFLYCARRYRYKSGI---QSLEDQKP 797
            T  + Q   ++R L   F IPP ++   +  ++ + +  YD V V  +RK+T +  GITLLQR+GIGMI  IL MI+A + ER R   A  H ++        +S+F L PQ +LMG  +AF  I ++EFF  Q P+ M+S+  S    S     ++SS+L++ V  +T + G   W+ N+++  RLD +Y   A L  LN + FL   R Y Y++ +    ++E ++P
Sbjct:  351 TLFIKQGTTLDRRLTNNFSIPPASLLGFTTFSMLVSIVIYDRVFVKFMRKLTGNPRGITLLQRMGIGMILHILIMIIASITERYRLKVAAEHGLTHQTAVPIPLSIFTLLPQYVLMGLADAFIEIAKLEFFYDQAPESMKSLGTSYTSTSMAVGYFMSSILLSSVSQITKKQGR-GWIQNNLNESRLDNYYMFFAVLNLLNFILFLVVIRFYEYRADVTQSANVEQKEP 578          
BLAST of CF835597 vs. ExPASy Swiss-Prot
Match: PTR3A_ARATH (Peptide transporter PTR3-A OS=Arabidopsis thaliana GN=PTR3-A PE=2 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 1.847e-31
Identity = 78/225 (34.67%), Postives = 122/225 (54.22%), Query Frame = -2
Query:  144 TFTVSQAMKMNRHLGPKFQIPPGTVGVISMITIGLWLPFYDTVLVPALRKITKHEGGITLLQRIGIGMIFSILSMIVAGLVERGRRASAHLHPMSQ-------VSVFWLAPQLILMGFCEAFNIIGQIEFFNKQFPDHMRSIANSLLFCSFGFASYLSSLLITIVHGVTARHGHPDWLTNDIDAGRLDYFYFLIAGLGGLNIVYFLYCARRYRYKSGIQSLEDQK 797
            T  V Q   ++R +   F IPP ++     +++ + +  YD V V   RK T +  GITLLQR+GIG+IF IL MIVA + ER R   A  H +         +++F L PQ +LMG  ++F  + ++EFF  Q P+ M+S+  S    S    +++SS L++ V  +T + G   W+ N+++  RLDY+Y   A L  +N V FL   + Y Y++ +    D K
Sbjct:  351 TLFVKQGTTLDRKVTGSFSIPPASLSGFVTLSMLISIVLYDRVFVKITRKFTGNPRGITLLQRMGIGLIFHILIMIVASVTERYRLKVAADHGLIHQTGVKLPLTIFALLPQFVLMGMADSFLEVAKLEFFYDQAPESMKSLGTSYSTTSLAIGNFMSSFLLSTVSEITKKRGR-GWILNNLNESRLDYYYLFFAVLNLVNFVLFLVVVKFYVYRAEVTDSVDVK 574          
BLAST of CF835597 vs. ExPASy Swiss-Prot
Match: CHL1_ARATH (Nitrate/chlorate transporter OS=Arabidopsis thaliana GN=CHL1 PE=1 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 2.497e-28
Identity = 73/212 (34.43%), Postives = 121/212 (57.08%), Query Frame = -2
Query:  174 TFTVSQAMKMNRHLGPKFQIPPGTVGVISMITIGLWLPFYDTVLVPALRKITKHEGGITLLQRIGIGMIFSILSMIVAGLVERGRRASAHLHPMS----QVSVFWLAPQLILMGFCEAFNIIGQIEFFNKQFPDHMRSIANSLLFCSFGFASYLSSLLITIVHGVTARHGHPDWLTNDIDAGRLDYFYFLIAGLGGLNIVYFLYCARRYRYK 797
            T +V+Q+  ++R +G  F+IPP ++ V  +  + L    YD V +   +K+  +  G+  LQRIG+G+ F  ++M VA LVE  R  +AH H  +     +  + L PQ +++G  EA    GQ++FF ++ P  M+ ++  LL  +     + SS+L+TIV   T +  HP W+ +D++ GRL  FY+L+A L  LN + FL  ++ Y YK
Sbjct:  361 TLSVAQSETLDRSIG-SFEIPPASMAVFYVGGLLLTTAVYDRVAIRLCKKLFNYPHGLRPLQRIGLGLFFGSMAMAVAALVELKRLRTAHAHGPTVKTLPLGFYLLIPQYLIVGIGEALIYTGQLDFFLRECPKGMKGMSTGLLLSTLALGFFFSSVLVTIVEKFTGK-AHP-WIADDLNKGRLYNFYWLVAVLVALNFLIFLVFSKWYVYK 569          
BLAST of CF835597 vs. ExPASy Swiss-Prot
Match: S15A3_HUMAN (Solute carrier family 15 member 3 OS=Homo sapiens GN=SLC15A3 PE=2 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.571e-14
Identity = 55/210 (26.19%), Postives = 99/210 (47.14%), Query Frame = -2
Query:  171 RHLGPKFQIPPGTVGVISMITIGLWLPFYDTVLVPALRKITKHEGGITLLQRIGIGMIFSILSMIVAGLVERGRRASAH------------LHPMSQVSVFWLAPQLILMGFCEAFNIIGQIEFFNKQFPDHMRSIANSLLFCSFGFASYLSSLLITIVHGVTARHGHPDWLTNDIDAGRLDYFYFLIAGLGGLNIVYFLYCARRYRYKS 764
            R  G  + IP   + + +++ + + +P  D ++ P L +          LQ++ +GM F   S+IVAG++E  R    H            L+  + +S++W  PQ +L+G  E F  I  +EF   + P  M+     + FC  G  S L S L+ ++  +     H      +I+  R+D ++FL+AG+  +  + F++ A RY   S
Sbjct:  362 RAQGSSYTIPEAWLLLANVVVVLILVPLKDRLIDPLLLRCKLLPSA---LQKMALGMFFGFTSVIVAGVLEMERLHYIHHNETVSQQIGEVLYNAAPLSIWWQIPQYLLIGISEIFASIPGLEFAYSEAPRSMQGAIMGIFFCLSGVGSLLGSSLVALL-SLPGGWLHCPKDFGNINNCRMDLYFFLLAGIQAVTALLFVWIAGRYERAS 567          
BLAST of CF835597 vs. ExPASy Swiss-Prot
Match: S15A3_RAT (Solute carrier family 15 member 3 OS=Rattus norvegicus GN=Slc15a3 PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 3.870e-13
Identity = 55/200 (27.50%), Postives = 95/200 (47.50%), Query Frame = -2
Query:  183 FQIPPGTVGVISMITIGLWLPFYDTVLVPALRKITKHEGGITLLQRIGIGMIFSILSMIVAGLVERGRRA------------SAHLHPMSQVSVFWLAPQLILMGFCEAFNIIGQIEFFNKQFPDHMRSIANSLLFCSFGFASYLSSLLITIVHGVTARHGHPDWLTNDIDAGRLDYFYFLIAGLGGLNIVYFLYCARRY 746
            ++IP   + + ++  I + +P  D ++ P L +          LQ++ +GM F   S+IVAG++E+ R                 L+  + +S++W  PQ +L+G  E F  I  +EF   + P  M+     + FC  G  S L S L+ ++         P    N I+  R+D ++FL+AG+  +  V FL+ A RY
Sbjct:  369 YRIPEAWLLLANVAVILILVPVKDHLIDPLLLRCKLLPSA---LQKMALGMFFGFTSIIVAGVLEKERLQYIAANQTVPQLIGKDLYYAAPLSIWWQIPQYLLIGISEIFASIPGLEFAYSEAPRSMQGAIMGIFFCLSGVGSLLGSGLVALLSLPGGWMYCPKDFGN-INNCRMDLYFFLLAGIQAVTAVLFLWIAGRY 564          
BLAST of CF835597 vs. ExPASy Swiss-Prot
Match: S15A3_MOUSE (Solute carrier family 15 member 3 OS=Mus musculus GN=Slc15a3 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.126e-12
Identity = 54/200 (27.00%), Postives = 95/200 (47.50%), Query Frame = -2
Query:  183 FQIPPGTVGVISMITIGLWLPFYDTVLVPALRKITKHEGGITLLQRIGIGMIFSILSMIVAGLVERGRRA------------SAHLHPMSQVSVFWLAPQLILMGFCEAFNIIGQIEFFNKQFPDHMRSIANSLLFCSFGFASYLSSLLITIVHGVTARHGHPDWLTNDIDAGRLDYFYFLIAGLGGLNIVYFLYCARRY 746
            ++IP   + + ++  I + +P  D ++ P L +          LQ++ +GM F   S+IVAG++E+ R                 L+  + +S++W  PQ +L+G  E F  I  +EF   + P  M+     + FC  G  S L S L+ ++         P    N I+  ++D ++FL+AG+  +  V FL+ A RY
Sbjct:  365 YRIPEAWLLLANVAVILILIPVKDHLIDPLLLRCKLLPSS---LQKMALGMFFGFTSIIVAGVLEKERLQYIAANQTVPQLIGKDLYYAAPLSIWWQIPQYLLIGVSEIFASIPGLEFAYSEAPRSMQGAIMGIFFCLSGVGSLLGSGLVALLSFPGGWMYCPKDFGN-INNCQMDRYFFLLAGIEAVTAVLFLWIAGRY 560          
The following BLAST results are available for this feature:
BLAST of CF835597 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 15
Match NameE-valueIdentityDescription
PTR5_ARATH1.009e-4541.12Peptide transporter PTR5 OS=Arabidopsis thaliana G... [more]
PTR1_ARATH3.246e-4437.96Peptide transporter PTR1 OS=Arabidopsis thaliana G... [more]
PTR2_ARATH4.540e-3837.85Peptide transporter PTR2 OS=Arabidopsis thaliana G... [more]
PTR2X_ARATH6.784e-3433.49Probable peptide transporter At1g52190 OS=Arabidop... [more]
PTR3B_ARATH4.862e-3234.93Peptide transporter PTR3-B OS=Arabidopsis thaliana... [more]
PTR3A_ARATH1.847e-3134.67Peptide transporter PTR3-A OS=Arabidopsis thaliana... [more]
CHL1_ARATH2.497e-2834.43Nitrate/chlorate transporter OS=Arabidopsis thalia... [more]
S15A3_HUMAN1.571e-1426.19Solute carrier family 15 member 3 OS=Homo sapiens ... [more]
S15A3_RAT3.870e-1327.50Solute carrier family 15 member 3 OS=Rattus norveg... [more]
S15A3_MOUSE1.126e-1227.00Solute carrier family 15 member 3 OS=Mus musculus ... [more]

Pages

back to top
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS03_01I16_f Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01I16, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835597 ID=CF835597|Name=CF835597|organism=Citrus sinensis|type=EST|length=801bp
TTTTTTTTTTTTTTTTTGAAAAAATACTGTTTCTTATACATCCATATTTT
ATTCAATACTATAGAACATTGATACTTTATTTATTTCTAGCTATCTACTA
TTCATTGTTTGGTTGGATCAACAAGCTCAAGATCAAGATAGGGTTTTTGA
TCTTCTAATGATTGGATACCACTCTTATACCGGTAACGACGTGCACAGTA
CAGAAAATAGACAATGTTAAGGCCTCCTAATCCTGCAATAAGGAAGTAGA
AATAATCTAATCTTCCAGCATCGATGTCATTAGTCAACCAGTCGGGGTGG
CCATGCCTTGCTGTGACTCCATGCACAATGGTGATAAGCAAACTGCTCAA
GTAACTTGCAAATCCAAAGGAGCAAAAGAGGAGAGAATTAGCAATACTTC
TCATGTGGTCAGGAAACTGCTTGTTAAAAAATTCGATCTGTCCAATTATG
TTGAATGCCTCACAAAACCCCATCAGGATAAGTTGAGGAGCTAGCCAGAA
GACTGATACTTGTGACATAGGGTGCAAATGGGCAGAAGCCCTTCTCCCTC
TTTCAACTAAACCAGCAACTATCATGGACAGTATTGAAAAAATCATCCCA
ATTCCAATTCTCTGAAGAAGTGTGATCCCTCCTTCATGTTTAGTGATTTT
GCGAAGAGCTGGGACAAGAACTGTGTCATAAAATGGGAGCCAGAGTCCTA
TTGTGATCATTGATATGACCCCCACTGTACCTGGAGGGATTTGGAACTTA
GGCCCAAGGTGTCTGTTCATTTTCATGGCCTGTGAAACTGTGAATGTTCC
T
back to top