CF835712

Overview
NameCF835712
Unique NameCF835712
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length837
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9906 contig Csv1_Contig9906:662..1498. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835712 vs. ExPASy Swiss-Prot
Match: COMT1_PRUDU (Caffeic acid 3-O-methyltransferase OS=Prunus dulcis GN=COMT1 PE=2 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 5.381e-61
Identity = 109/209 (52.15%), Postives = 148/209 (70.81%), Query Frame = -3
Query:  209 NKALGMDFYDYLGTDSRFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXISKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAGFKGINFECNVCNSYVMEFYK 835
            NKA GM  ++Y GTD RFN+VFN GM   ++  + KI+E+YKGF+ +T +VDV           +SKYP IKGINFD+PHVI+DA  YPG+EHVGGDM+  +P+GDAI MKW+ H++ DE+C+K L+NCY ALP++GKV++    LP  PDS+ A++    +D I L   P G+ERT++EF ALA  AGF+G N  C+  N+YV+EF K
Sbjct:  155 NKAYGMTAFEYHGTDPRFNKVFNRGMADHSTITMKKILETYKGFEGLTSVVDVGGGTGAVLNMIVSKYPSIKGINFDLPHVIEDAPQYPGVEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDNGKVILGECILPVAPDSSLATKGVVHIDVIMLAHNPGGKERTEQEFQALAKGAGFQGFNVACSAFNTYVIEFLK 363          
BLAST of CF835712 vs. ExPASy Swiss-Prot
Match: OMT2_CHRAE (Quercetin 3-O-methyltransferase 2 OS=Chrysosplenium americanum GN=OMT2 PE=1 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 7.028e-61
Identity = 108/209 (51.67%), Postives = 148/209 (70.81%), Query Frame = -3
Query:  209 NKALGMDFYDYLGTDSRFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXISKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAGFKGINFECNVCNSYVMEFYK 835
            NKA GM  ++Y GTD RFN+VFN GM   ++  + K+ ++Y+GFQ +T LVDV           +SKYP I+ INFD+PHVI+DA  YPG+EHVGGDM+  +P+GDAI MKW+ H++ DE+C+K+L+NCY ALPN+GKV++    LPEVPDS+ A++    +D I +   P G+ERT+KEF ALA  AGF+G    CN  N+Y++EF K
Sbjct:  131 NKAYGMSSFEYHGTDPRFNKVFNRGMSDHSTITMKKVFQTYQGFQGLTSLVDVGGGTGATLTMILSKYPTIRCINFDLPHVIEDAPEYPGIEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKLLKNCYDALPNNGKVILAECILPEVPDSSLATKGVVHIDVITVAHNPGGKERTEKEFEALAKAAGFQGFQVFCNAFNTYIIEFSK 339          
BLAST of CF835712 vs. ExPASy Swiss-Prot
Match: OMT1_CHRAE (Quercetin 3-O-methyltransferase 1 OS=Chrysosplenium americanum GN=OMT1 PE=1 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 7.028e-61
Identity = 108/209 (51.67%), Postives = 148/209 (70.81%), Query Frame = -3
Query:  209 NKALGMDFYDYLGTDSRFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXISKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAGFKGINFECNVCNSYVMEFYK 835
            NKA GM  ++Y GTD RFN+VFN GM   ++  + K+ ++Y+GFQ +T LVDV           +SKYP I+ INFD+PHVI+DA  YPG+EHVGGDM+  +P+GDAI MKW+ H++ DE+C+K+L+NCY ALPN+GKV++    LPEVPDS+ A++    +D I +   P G+ERT+KEF ALA  AGF+G    CN  N+Y++EF K
Sbjct:  131 NKAYGMSSFEYHGTDPRFNKVFNRGMSDHSTITMKKVFQAYQGFQGLTSLVDVGGGTGATLTMILSKYPTIRCINFDLPHVIEDAPEYPGIEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKLLKNCYDALPNNGKVILAECILPEVPDSSLATKGVVHIDVITVAHNPGGKERTEKEFEALAKAAGFQGFQVFCNAFNTYIIEFSK 339          
BLAST of CF835712 vs. ExPASy Swiss-Prot
Match: COMT1_ROSCH (Caffeic acid 3-O-methyltransferase OS=Rosa chinensis GN=COMT1 PE=2 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 9.178e-61
Identity = 107/209 (51.20%), Postives = 148/209 (70.81%), Query Frame = -3
Query:  209 NKALGMDFYDYLGTDSRFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXISKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAGFKGINFECNVCNSYVMEFYK 835
            NKA GM  +DY GTD RFN+VFN GM   ++  + KI+E+YKGF+ +T +VDV           +SKYP IKGINFD+PHVI+DA  YPG++HVGGDM+  +P+GDAI MKW+ H++ DE+C+K L+NCY ALP++GKV++    LP  PD++ A++    +D + L   P G+ERT++EF ALA  +GF+GI   CN  N+YV+EF K
Sbjct:  155 NKAYGMTAFDYHGTDPRFNKVFNKGMADHSTITMKKILETYKGFEGLTSIVDVGGGTGAVVNMIVSKYPSIKGINFDLPHVIEDAPQYPGVQHVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDNGKVILGECILPVAPDTSLATKGVVHIDVVMLAHNPGGKERTEQEFEALAKGSGFQGIRVACNAFNTYVIEFLK 363          
BLAST of CF835712 vs. ExPASy Swiss-Prot
Match: OMT1_ARATH (Quercetin 3-O-methyltransferase 1 OS=Arabidopsis thaliana GN=OMT1 PE=1 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 1.566e-60
Identity = 107/209 (51.20%), Postives = 148/209 (70.81%), Query Frame = -3
Query:  209 NKALGMDFYDYLGTDSRFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXISKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAGFKGINFECNVCNSYVMEFYK 835
            NKA GM  ++Y GTD RFN+VFNNGM   ++  + KI+E+YKGF+ +T LVDV           +SKYP++KGINFD+PHVI+DA S+PG+EHVGGDM+  +P+GDAI MKW+ H++ DE+C+K L+NCY++LP DGKV++    LPE PDS+ +++    +D I L   P G+ERT+KEF ALA  +GFKGI   C+     ++E  K
Sbjct:  153 NKAYGMSAFEYHGTDPRFNKVFNNGMSNHSTITMKKILETYKGFEGLTSLVDVGGGIGATLKMIVSKYPNLKGINFDLPHVIEDAPSHPGIEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCVKFLKNCYESLPEDGKVILAECILPETPDSSLSTKQVVHVDCIMLAHNPGGKERTEKEFEALAKASGFKGIKVVCDAFGVNLIELLK 361          
BLAST of CF835712 vs. ExPASy Swiss-Prot
Match: COMT1_MEDSA (Caffeic acid 3-O-methyltransferase OS=Medicago sativa PE=1 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 1.566e-60
Identity = 109/209 (52.15%), Postives = 145/209 (69.38%), Query Frame = -3
Query:  209 NKALGMDFYDYLGTDSRFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXISKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAGFKGINFECNVCNSYVMEFYK 835
            NKA GM  ++Y GTD RFN+VFN GM   ++  + KI+E+Y GF+ +  LVDV           +SKYP IKGINFD+PHVI+DA SYPG+EHVGGDM+  IP+ DA+ MKW+ H++ DE+C+K L+NCY+ALP++GKV+V    LP  PDS+ A++    +D I L   P G+ERT+KEF  LA  AGF+G    CN  N+Y+MEF K
Sbjct:  155 NKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKILETYTGFEGLKSLVDVGGGTGAVINTIVSKYPTIKGINFDLPHVIEDAPSYPGVEHVGGDMFVSIPKADAVFMKWICHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDVIMLAHNPGGKERTQKEFEDLAKGAGFQGFKVHCNAFNTYIMEFLK 363          
BLAST of CF835712 vs. ExPASy Swiss-Prot
Match: COMT1_CLABR (Caffeic acid 3-O-methyltransferase OS=Clarkia breweri GN=COMT PE=1 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 1.731e-59
Identity = 110/209 (52.63%), Postives = 141/209 (67.46%), Query Frame = -3
Query:  209 NKALGMDFYDYLGTDSRFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXISKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAGFKGINFECNVCNSYVMEFYK 835
            NKA GM  ++Y GTD RFN+VFN GM   ++  + KI E Y GF+ +  +VDV           ++KYP IKGINFD+PHVI+DA  YPG+EHVGGDM+  +P+GDAI MKW+ H++ DE+C+K L+NCY ALP  GKV+V    LP  PD + A++    +DAI L   P G+ERT+KEF ALAI AGFKG    C   N+YVMEF K
Sbjct:  160 NKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKIFEMYTGFEALNTIVDVGGGTGAVLSMIVAKYPSIKGINFDLPHVIEDAPIYPGVEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPEHGKVIVAECILPLSPDPSLATKGVIHIDAIMLAHNPGGKERTEKEFEALAIGAGFKGFKVACCAFNTYVMEFLK 368          
BLAST of CF835712 vs. ExPASy Swiss-Prot
Match: COMT1_ZINEL (Caffeic acid 3-O-methyltransferase OS=Zinnia elegans PE=2 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 8.591e-59
Identity = 106/209 (50.72%), Postives = 144/209 (68.90%), Query Frame = -3
Query:  209 NKALGMDFYDYLGTDSRFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXISKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAGFKGINFECNVCNSYVMEFYK 835
            NKA GM  ++Y G D RFN+VFN+GM   ++  + KIVE Y GF  +  LVDV            SK+  +KGINFD+PHVI DA++Y G+EHVGGDM++ +P+GDAI MKW+LH++ D +C+++L+NCYK+LP +GKV+V    LPE PD+T A+++   +D I L   P G+ERT+KEF ALA  AGFKG N      N++VMEF K
Sbjct:  146 NKAYGMSAFEYHGKDQRFNKVFNSGMFNHSTMTMKKIVELYNGFSGLKTLVDVGGGTGASLNMITSKHKSLKGINFDLPHVIADATTYQGIEHVGGDMFESVPKGDAIFMKWILHDWSDAHCLQVLKNCYKSLPENGKVIVAECILPEAPDTTPATQNVIHIDVIMLAHNPGGKERTEKEFEALAKGAGFKGFNKAACALNTWVMEFCK 354          
BLAST of CF835712 vs. ExPASy Swiss-Prot
Match: COMT1_OCIBA (Caffeic acid 3-O-methyltransferase 1 OS=Ocimum basilicum GN=COMT1 PE=2 SV=1)

HSP 1 Score: 226.868 bits (577), Expect = 1.122e-58
Identity = 106/209 (50.72%), Postives = 142/209 (67.94%), Query Frame = -3
Query:  209 NKALGMDFYDYLGTDSRFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXISKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAGFKGINFECNVCNSYVMEFYK 835
            NKA GM  ++Y GTD RFN+VFN GM   ++  + KI+E+Y GF  +  +VDV           +SKYP IKGINFD+PHVI+DA SYPG+EHVGGDM+  +P+GDAI MKW+ H++ DE+C+K L+NCY ALP +GKV++    LPE PD+  A+++   +D I L   P G+ERT+KEF  LA  AGFK  N  C   N+++ME  K
Sbjct:  153 NKAYGMTAFEYHGTDPRFNKVFNQGMSNHSTITMKKILETYTGFDGLKTVVDVGGGTGATLNMIVSKYPSIKGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCVKFLKNCYDALPQNGKVILAECVLPEAPDTGLATKNVVHIDVIMLAHNPGGKERTEKEFQGLAKAAGFKQFNKACCAYNTWIMELLK 361          
BLAST of CF835712 vs. ExPASy Swiss-Prot
Match: COMT1_POPTM (Caffeic acid 3-O-methyltransferase 1 OS=Populus tremuloides GN=OMT1 PE=1 SV=1)

HSP 1 Score: 226.098 bits (575), Expect = 1.914e-58
Identity = 105/209 (50.24%), Postives = 144/209 (68.90%), Query Frame = -3
Query:  209 NKALGMDFYDYLGTDSRFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXISKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAGFKGINFECNVCNSYVMEFYK 835
            NKA GM  ++Y GTD RFN+VFN GM   ++  + KI+E+YKGF+ +T LVDV           +SKYP IKGINFD+PHVI+DA SYPG+EHVGGDM+  +P+ DA+ MKW+ H++ D +C+K L+NCY ALP +GKV+++   LP  PD++ A++    +D I L   P G+ERT+KEF  LA  AGF+G    C   N++V+EF K
Sbjct:  155 NKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKILETYKGFEGLTSLVDVGGGTGAVVNTIVSKYPSIKGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKADAVFMKWICHDWSDAHCLKFLKNCYDALPENGKVILVECILPVAPDTSLATKGVVHVDVIMLAHNPGGKERTEKEFEGLAKGAGFQGFEVMCCAFNTHVIEFRK 363          
The following BLAST results are available for this feature:
BLAST of CF835712 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 42
Match NameE-valueIdentityDescription
COMT1_PRUDU5.381e-6152.15Caffeic acid 3-O-methyltransferase OS=Prunus dulci... [more]
OMT2_CHRAE7.028e-6151.67Quercetin 3-O-methyltransferase 2 OS=Chrysospleniu... [more]
OMT1_CHRAE7.028e-6151.67Quercetin 3-O-methyltransferase 1 OS=Chrysospleniu... [more]
COMT1_ROSCH9.178e-6151.20Caffeic acid 3-O-methyltransferase OS=Rosa chinens... [more]
OMT1_ARATH1.566e-6051.20Quercetin 3-O-methyltransferase 1 OS=Arabidopsis t... [more]
COMT1_MEDSA1.566e-6052.15Caffeic acid 3-O-methyltransferase OS=Medicago sat... [more]
COMT1_CLABR1.731e-5952.63Caffeic acid 3-O-methyltransferase OS=Clarkia brew... [more]
COMT1_ZINEL8.591e-5950.72Caffeic acid 3-O-methyltransferase OS=Zinnia elega... [more]
COMT1_OCIBA1.122e-5850.72Caffeic acid 3-O-methyltransferase 1 OS=Ocimum bas... [more]
COMT1_POPTM1.914e-5850.24Caffeic acid 3-O-methyltransferase 1 OS=Populus tr... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01M03_f Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01M03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835712 ID=CF835712|Name=CF835712|organism=Citrus sinensis|type=EST|length=837bp
TTTTTTTTTTTTTTTTTATACCAAACACAAACAGGACTTATATTACTGAA
CACACAAAAGCATTACATAAGAAGTTCCCGCGAGCCATAAAGGCCAAACA
AAACAGAAAGTTACAGAAAAGAAAATGGAGTATCGACACTCCAAATTAAA
ATTGAGAAGATGCATCTTTCTGATAAAGAAAGAATGAAGCAATCTAGCTT
CAAAGTTACTTGTAGAATTCCATGACATAGGAATTGCAAACGTTACATTC
AAAGTTGATACCCTTAAATCCAGCTTCGATTGCCAATGCAGTGAACTCCT
TTTTGGTCCGCTCCCTTCCATGAGGAATTTGGATTAAAAAAATTGCATCT
AAAATGAAGGAATCCCTTGAAGCCTCGGTACTGTCAGGCACTTCTGGCAA
CGTTGAGTTAATAACAAGTACCTTTCCATCATTTGGAAGAGCTTTGTAAC
AATTCCTCAGTATCTTTATGCAATTCTCATCATCAAAATTATGAAGCATC
CACTTCATTAAAATGGCATCCCCCTCTGGAATTTTTTGGTACATATCTCC
GCCAACATGTTCCATGCCGGGATAAGATGAGGCATCTTTTATAACATGAG
GTACGTCAAAATTAATACCCTTAATATGAGGGTATTTGGAAATTATGGTC
GCAAGGGTGATTCCTAAACCACCGCCAACGTCAACAAGGCGCGTAATATT
CTGAAAGCCTTTGTAGGATTCTACAATCTTATTGATTACAAAAGAAGTCT
GGCCGATCATTCCATTGTTGAAAACTTCATTGAACCTGGAGTCGGTGCCC
AGATAATCGTAGAAATCCATTCCGAGGGCTTTATTAT
back to top