CF835713

Overview
NameCF835713
Unique NameCF835713
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length719
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6651 contig Csv1_Contig6651:389..1108. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835713 vs. ExPASy Swiss-Prot
Match: PPA1_SOLLC (Acid phosphatase 1 OS=Solanum lycopersicum GN=APS1 PE=2 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 9.909e-47
Identity = 88/189 (46.56%), Postives = 125/189 (66.14%), Query Frame = -3
Query:  151 ADYVGHYMLAQQYRLDSEVVANEAILHAQSLTLAGDGKDIWVFDIDETSLCNLPYYAKNGFGVKPYNPTMFNEWVNTGKAXXXXXXXXXXXXXXXLGIKIVFLTGRPEDQRNVTEANLKHAGFNTWEKLILKGSSHSGETAVVYKSSERKKLEMKGYRIIGNIGDQWSDLLGTNAGNRTFKLPDPMYYI 717
            ADYV  YM+   Y+++ + V++EA  +A+S+ L  DG+D+W+FD+DET L NLPYY+ + +G++ ++   F++WV  G A               LG K+  LTGR E  R+VT  NL +AGF+ W KLIL+GS   G+TA  YKS  R  +  +G+RI+GN GDQWSDLLG++   R+FKLP+PMYYI
Sbjct:   66 ADYVKEYMVGPGYKMEIDRVSDEAGEYAKSVDLGDDGRDVWIFDVDETLLSNLPYYSDHRYGLEVFDDVEFDKWVENGTAPALGSSLKLYQEVLKLGFKVFLLTGRSERHRSVTVENLMNAGFHDWHKLILRGSDDHGKTATTYKSERRNAMVEEGFRIVGNSGDQWSDLLGSSMSYRSFKLPNPMYYI 254          
BLAST of CF835713 vs. ExPASy Swiss-Prot
Match: VSPA_SOYBN (Stem 28 kDa glycoprotein OS=Glycine max GN=VSPA PE=2 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 5.089e-43
Identity = 93/185 (50.27%), Postives = 124/185 (67.03%), Query Frame = -3
Query:  151 YMLAQQYRLDSEVVANEAILHAQSLTLAGDGKDIWVFDIDETSLCNLPYYAKNGFGVKPYNPTMFNEWVNTGKAXXXXXXXXXXXXXXXLGIKIVFLTGRPEDQRNVTEANLKHAGFNTWEKLILKG-SSHSGETAVVYKSSERKKLEMKGYRIIGNIGDQWSDLLGTNAG-NRTFKLPDPMYYI 699
            Y+  +QYR DS+ V  +A  +A+ L +    KD +VF ID T L N+PYY K+G+GV+ +N T+++EWVN G A               LG KI+FL+GR  D++ VTEANLK AG++TWEKLILK     S   AV YK++ R+KL  +GY I+G IGDQWSDLLG + G +RTFKLP+P+YYI
Sbjct:   71 YIHGEQYRSDSKTVNQQAYFYARDLEV--HPKDTFVFSIDGTVLSNIPYYKKHGYGVEKFNSTLYDEWVNKGNAPALPETLKNYNKLVSLGFKIIFLSGRTLDKQAVTEANLKKAGYHTWEKLILKDPQDPSTPNAVSYKTAAREKLIRQGYNIVGIIGDQWSDLLGGHRGESRTFKLPNPLYYI 253          
BLAST of CF835713 vs. ExPASy Swiss-Prot
Match: VSPB_SOYBN (Stem 31 kDa glycoprotein OS=Glycine max GN=VSPB PE=2 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 5.627e-42
Identity = 91/184 (49.46%), Postives = 121/184 (65.76%), Query Frame = -3
Query:  151 YMLAQQYRLDSEVVANEAILHAQSLTLAGDGKDIWVFDIDETSLCNLPYYAKNGFGVKPYNPTMFNEWVNTGKAXXXXXXXXXXXXXXXLGIKIVFLTGRPEDQRNVTEANLKHAGFNTWEKLILKGSSHSGETAVVYKSSERKKLEMKGYRIIGNIGDQWSDLLGTNAG-NRTFKLPDPMYYI 699
            Y+  +Q+R DS+ V  +A  +A    +  +  DI++F ID T L N+PYY K+G+GV+ +N T+++EWVN G A               LG KIVFL+GR  D+  VTEANLK AGF+TWE+LILK        A+ YKS+ R+ L  +GYRI+G IGDQWSDLLG + G +RTFKLP+PMYYI
Sbjct:   72 YINGEQFRSDSKTVNQQAFFYASEREVHHN--DIFIFGIDNTVLSNIPYYEKHGYGVEEFNETLYDEWVNKGDAPALPETLKNYNKLLSLGFKIVFLSGRYLDKMAVTEANLKKAGFHTWEQLILKDPHLITPNALSYKSAMRENLLRQGYRIVGIIGDQWSDLLGDHRGESRTFKLPNPMYYI 253          
BLAST of CF835713 vs. ExPASy Swiss-Prot
Match: S25K_SOYBN (Stem 31 kDa glycoprotein (Fragment) OS=Glycine max GN=VSP25 PE=2 SV=2)

HSP 1 Score: 166.777 bits (421), Expect = 1.061e-40
Identity = 90/181 (49.72%), Postives = 120/181 (66.30%), Query Frame = -3
Query:  163 YMLAQQYRLDSEVVANEAILHAQSLTLAGDGKDIWVFDIDETSLCNLPYYAKNGFGVKPYNPTMFNEWVNTGKAXXXXXXXXXXXXXXXLGIKIVFLTGRPEDQRNVTEANLKHAGFNTWEKLILKG-SSHSGETAVVYKSSERKKLEMKGYRIIGNIGDQWSDLLGTNAG-NRTFKLPDP 699
            Y+  +QYR DS+ V  +A  +A+ L +    KD +VF ID T L N+PYY K+G+GV+ +N T+++EWVN G A               LG KI+FL+GR  D++ VTEANLK AG++TWEKLILK     S   AV YK++ R+KL  +GY I+G IGDQWSDLLG + G +RTFKLP+P
Sbjct:   68 YIHGEQYRSDSKTVNQQAYFYARDLEV--HPKDTFVFSIDGTVLSNIPYYKKHGYGVEKFNSTLYDEWVNKGNAPALPETLKNYNKLVSLGFKIIFLSGRTLDKQAVTEANLKKAGYHTWEKLILKDPQDPSTPNAVSYKTAAREKLIRQGYNIVGIIGDQWSDLLGGHRGESRTFKLPNP 246          
BLAST of CF835713 vs. ExPASy Swiss-Prot
Match: VSP2_ARATH (Vegetative storage protein 2 OS=Arabidopsis thaliana GN=VSP2 PE=1 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 5.640e-34
Identity = 80/190 (42.11%), Postives = 114/190 (60.00%), Query Frame = -3
Query:  151 DYVGHYML-AQQYRLDSEVVANEAILHAQSLTLAGDGKDIWVFDIDETSLCNLPYYAKNGFGVKPYNPTMFNEWVNTG-KAXXXXXXXXXXXXXXXLGIKIVFLTGRPEDQRNVTEANLKHAGFNTWEKLILKGSSHSGETAVVYKSSERKKLEMKGYRIIGNIGDQWSDLLGTNAGNRTFKLPDPMYYI 714
            DYV  Y++ ++QY+ DS+ V  EA  +A+ L L  D  ++W+FD+D+T L ++PYYAK G+G +  +P  +  W+ TG                  LGI+ + L+ R +  +NVT  NL+ AG   W+ LILK +  S    VVYKS  RK L  KGY I+GNIGDQW+DL+    G R FKLP+P+YY+
Sbjct:   76 DYVEDYLITSKQYQYDSKTVCKEAYFYAKGLALKNDTVNVWIFDLDDTLLSSIPYYAKYGYGTEKTDPGAYWLWLGTGASTPGLPEALHLYQNIIELGIEPIILSDRWKLWKNVTLDNLEAAGVTYWKHLILKPNG-SNLRQVVYKSKVRKSLVKKGYNIVGNIGDQWADLVEDTPG-RVFKLPNPLYYV 263          
BLAST of CF835713 vs. ExPASy Swiss-Prot
Match: VSP1_ARATH (Vegetative storage protein 1 OS=Arabidopsis thaliana GN=VSP1 PE=2 SV=2)

HSP 1 Score: 137.887 bits (346), Expect = 5.279e-32
Identity = 76/189 (40.21%), Postives = 111/189 (58.73%), Query Frame = -3
Query:  151 YVGHYML-AQQYRLDSEVVANEAILHAQSLTLAGDGKDIWVFDIDETSLCNLPYYAKNGFGVKPYNPTMFNEWVNTGKA-XXXXXXXXXXXXXXXLGIKIVFLTGRPEDQRNVTEANLKHAGFNTWEKLILKGSSHSGETAVVYKSSERKKLEMKGYRIIGNIGDQWSDLLGTNAGNRTFKLPDPMYYI 711
            YV  Y++ ++QY+ DS+ V  EA  +A+ L L  D  ++W+FD+D+T L ++PYYAK G+G +   P  +  W+ +G++                LGI+ + ++ R +    VT  NLK  G   W+ LILK +  S  T VVYKS  R  L  KGY I+GNIGDQW+DL+    G R FKLP+P+YY+
Sbjct:   82 YVEDYLITSKQYQYDSKTVNKEAYFYAKGLALKNDTVNVWIFDLDDTLLSSIPYYAKYGYGTENTAPGAYWSWLESGESTPGLPETLHLYENLLELGIEPIIISDRWKKLSEVTVENLKAVGVTKWKHLILKPNG-SKLTQVVYKSKVRNSLVKKGYNIVGNIGDQWADLVEDTPG-RVFKLPNPLYYV 268          
The following BLAST results are available for this feature:
BLAST of CF835713 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
PPA1_SOLLC9.909e-4746.56Acid phosphatase 1 OS=Solanum lycopersicum GN=APS1... [more]
VSPA_SOYBN5.089e-4350.27Stem 28 kDa glycoprotein OS=Glycine max GN=VSPA PE... [more]
VSPB_SOYBN5.627e-4249.46Stem 31 kDa glycoprotein OS=Glycine max GN=VSPB PE... [more]
S25K_SOYBN1.061e-4049.72Stem 31 kDa glycoprotein (Fragment) OS=Glycine max... [more]
VSP2_ARATH5.640e-3442.11Vegetative storage protein 2 OS=Arabidopsis thalia... [more]
VSP1_ARATH5.279e-3240.21Vegetative storage protein 1 OS=Arabidopsis thalia... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01M03_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01M03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835713 ID=CF835713|Name=CF835713|organism=Citrus sinensis|type=EST|length=719bp
TTTTTTTTTATCGATAATCCTAATTATATTAATTAGCTAATGCAGTACAA
TGGATCAGACAGCTTGAAAGTTAAGCAAATTTGGTGCACAAATGAAGGCC
CTTCGATTATTTATTCAAAATCCCAAGTAAACATTATTTATTAATTAGCC
AATGTAATACATTGGGTCAGGCAGCTTGAACGTCCGATTGCCGGCGTTGG
TGCCCAGGAGATCGCTCCATTGATCACCTATGTTTCCAATAATTCTGTAC
CCTTTCATCTCAAGCTTCTTTCTTTCACTTGATTTGTACACCACTGCTGT
TTCTCCTGAATGAGATGATCCCTTGAGGATGAGCTTCTCCCAAGTGTTGA
ATCCAGCATGCTTTAAATTAGCTTCTGTAACATTTCTCTGATCTTCTGGT
CTTCCCGTGAGGAATACAATCTTAATTCCAAGCAATAATAATTTTTTGTA
AAGCTTAAGGCTCTCTGGCAGCGGTGGTGCTTTTCCGGTGTTAACCCATT
CATTAAACATAGTAGGGTTGTACGGCTTCACCCCGAATCCATTCTTAGCA
TAATATGGCAAATTACATAGCGAGGTTTCATCTATGTCGAAAACCCAAAT
GTCCTTGCCGTCGCCAGCAAGCGTGAGGCTCTGAGCATGGAGAATGGCCT
CATTAGCAACCACTTCAGAGTCCAGGCGGTACTGCTGGGCTAACATGTAA
TGCCCCACGTAGTCTGCAC
back to top