CF835902

Overview
NameCF835902
Unique NameCF835902
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length585
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF835902 vs. ExPASy Swiss-Prot
Match: SF3BB_ARATH (Uncharacterized protein At4g14342 OS=Arabidopsis thaliana GN=At4g14342 PE=3 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 2.998e-39
Identity = 77/87 (88.51%), Postives = 80/87 (91.95%), Query Frame = -3
Query:  308 MQVSDRSNINSQLEHLQAKSVGTGHGDLIRFEWAVNIQRDSYASYIGHCPMLAYFAIAENESIGRELYNFMQKMLLPCGLPPEREDD 568
            MQ SDR NINSQLEHLQAK VGTGH DL RFEWAVNIQRDSYASYIGH PML+YFAIAENESIGRE YNFMQKMLLPCGLPPERE++
Sbjct:    1 MQASDRFNINSQLEHLQAKYVGTGHADLSRFEWAVNIQRDSYASYIGHYPMLSYFAIAENESIGRERYNFMQKMLLPCGLPPEREEE 87          
BLAST of CF835902 vs. ExPASy Swiss-Prot
Match: SF3BA_ARATH (Uncharacterized protein At3g23325 OS=Arabidopsis thaliana GN=At3g23325 PE=2 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 2.998e-39
Identity = 77/87 (88.51%), Postives = 79/87 (90.80%), Query Frame = -3
Query:  308 MQVSDRSNINSQLEHLQAKSVGTGHGDLIRFEWAVNIQRDSYASYIGHCPMLAYFAIAENESIGRELYNFMQKMLLPCGLPPEREDD 568
            MQ SDR NINSQLEHLQAK VGTGH DL RFEW VNIQRDSYASYIGH PML+YFAIAENESIGRE YNFMQKMLLPCGLPPERED+
Sbjct:    1 MQASDRFNINSQLEHLQAKYVGTGHADLSRFEWTVNIQRDSYASYIGHYPMLSYFAIAENESIGRERYNFMQKMLLPCGLPPEREDE 87          
BLAST of CF835902 vs. ExPASy Swiss-Prot
Match: SF3B5_DROME (Probable splicing factor 3B subunit 5 OS=Drosophila melanogaster GN=CG11985 PE=1 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 1.766e-23
Identity = 50/85 (58.82%), Postives = 63/85 (74.12%), Query Frame = -3
Query:  308 VSDRSNINSQLEHLQAKSVGTGHGDLIRFEWAVNIQRDSYASYIGHCPMLAYFAIAENESIGRELYNFMQKMLLPCGLPPEREDD 562
            + +R NI+SQLEHLQ+K +GTGH D  +FEW  N  RDS ASY+GH  +L YFAIAENES  R  +N M++ML PCG PPE+ +D
Sbjct:    1 MGERYNIHSQLEHLQSKYIGTGHADTTKFEWLTNQHRDSLASYMGHYDILNYFAIAENESKARVRFNLMERMLQPCGPPPEKLED 85          
BLAST of CF835902 vs. ExPASy Swiss-Prot
Match: SF3B5_HUMAN (Splicing factor 3B subunit 5 OS=Homo sapiens GN=SF3B5 PE=1 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.144e-22
Identity = 48/85 (56.47%), Postives = 63/85 (74.12%), Query Frame = -3
Query:  308 VSDRSNINSQLEHLQAKSVGTGHGDLIRFEWAVNIQRDSYASYIGHCPMLAYFAIAENESIGRELYNFMQKMLLPCGLPPEREDD 562
            ++DR  I+SQLEHLQ+K +GTGH D  ++EW VN  RDSY SY+GH  +L YFAIAENES  R  +N M+KML PCG P ++ ++
Sbjct:    1 MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEE 85          
BLAST of CF835902 vs. ExPASy Swiss-Prot
Match: SF3B5_BOVIN (Splicing factor 3B subunit 5 OS=Bos taurus GN=SF3B5 PE=3 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.144e-22
Identity = 48/85 (56.47%), Postives = 63/85 (74.12%), Query Frame = -3
Query:  308 VSDRSNINSQLEHLQAKSVGTGHGDLIRFEWAVNIQRDSYASYIGHCPMLAYFAIAENESIGRELYNFMQKMLLPCGLPPEREDD 562
            ++DR  I+SQLEHLQ+K +GTGH D  ++EW VN  RDSY SY+GH  +L YFAIAENES  R  +N M+KML PCG P ++ ++
Sbjct:    1 MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEE 85          
BLAST of CF835902 vs. ExPASy Swiss-Prot
Match: SF3B5_MOUSE (Splicing factor 3B subunit 5 OS=Mus musculus GN=Sf3b5 PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 1.652e-21
Identity = 47/85 (55.29%), Postives = 62/85 (72.94%), Query Frame = -3
Query:  308 VSDRSNINSQLEHLQAKSVGTGHGDLIRFEWAVNIQRDSYASYIGHCPMLAYFAIAENESIGRELYNFMQKMLLPCGLPPEREDD 562
            ++DR  I+SQLEHLQ+K +GTGH D  ++EW VN  RDSY SY+GH  +L YFAIAENES  R  +N M+KML P G P ++ ++
Sbjct:    1 MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPSGPPADKPEE 85          
BLAST of CF835902 vs. ExPASy Swiss-Prot
Match: SF3B5_DICDI (Splicing factor 3B subunit 5 OS=Dictyostelium discoideum GN=sf3b5 PE=3 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 6.279e-21
Identity = 45/85 (52.94%), Postives = 62/85 (72.94%), Query Frame = -3
Query:  308 VSDRSNINSQLEHLQAKSVGTGHGDLIRFEWAVNIQRDSYASYIGHCPMLAYFAIAENESIGRELYNFMQKMLLPCGLPPEREDD 562
            +S+R ++NSQLEHLQ + VGTGH D+ + EW  N  RDS +S+IGH   L+ F+IAENES+GR  YN + KM+ PCG  P+ +D+
Sbjct:    1 MSERESLNSQLEHLQMRYVGTGHADISKHEWLTNQHRDSLSSFIGHSSFLSLFSIAENESVGRVRYNTLTKMISPCGPAPKIKDN 85          
BLAST of CF835902 vs. ExPASy Swiss-Prot
Match: YHV5_SCHPO (Uncharacterized protein C211.05 OS=Schizosaccharomyces pombe GN=SPBC211.05 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 8.220e-13
Identity = 34/80 (42.50%), Postives = 51/80 (63.75%), Query Frame = -3
Query:  323 VSDRSNINSQLEHLQAKSVGTGHGDLIRFEWAVNIQRDSYASYIGHCPMLAYFAIAENESIGRELYNFMQKMLLPCGLPP 562
            ++DR    ++LE LQA+ VG G+    ++EW VN  RD+ +S +GH P+LAY A A  E   +   N ++KM++PCG PP
Sbjct:    1 MADRLRSQAKLEQLQARYVGVGNAFTTKYEWMVNQHRDTLSSVVGHPPLLAYMATALGEPRVQVRKNLLEKMIMPCGPPP 80          
The following BLAST results are available for this feature:
BLAST of CF835902 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
SF3BB_ARATH2.998e-3988.51Uncharacterized protein At4g14342 OS=Arabidopsis t... [more]
SF3BA_ARATH2.998e-3988.51Uncharacterized protein At3g23325 OS=Arabidopsis t... [more]
SF3B5_DROME1.766e-2358.82Probable splicing factor 3B subunit 5 OS=Drosophil... [more]
SF3B5_HUMAN1.144e-2256.47Splicing factor 3B subunit 5 OS=Homo sapiens GN=SF... [more]
SF3B5_BOVIN1.144e-2256.47Splicing factor 3B subunit 5 OS=Bos taurus GN=SF3B... [more]
SF3B5_MOUSE1.652e-2155.29Splicing factor 3B subunit 5 OS=Mus musculus GN=Sf... [more]
SF3B5_DICDI6.279e-2152.94Splicing factor 3B subunit 5 OS=Dictyostelium disc... [more]
YHV5_SCHPO8.220e-1342.50Uncharacterized protein C211.05 OS=Schizosaccharom... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_02B12_f Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa02B12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835902 ID=CF835902; Name=CF835902; organism=Citrus sinensis; type=EST; length=585bp
TTTTTTTTTTTTTTTTCCACAAAGGAAGCAGGGCAGCGGATACATCTTTT
CAGATCCATGGCCTTCACACCCTAATTTAGACAATTCCTCAGCACATTGA
GTAACTACGTAAAAATTTATATAATTCCAAGGATTGCAACAACACTCGAG
CATTCATTTCACTACACACTACTACAAAATTTTGTCAGTGTCACATGAAC
ATGGTTCCTTGAAGAGAACACCTAAATATATCACAAATGCTCCTCAGCCT
GGAGAGAGCTGGACCCCAAAATGCTTCATTTCTCAGAAAGGGCATCCTAA
ACTCTCAATCATCTTCTCTTTCAGGGGGTAAGCCGCAAGGCAAAAGCATT
TTCTGCATAAAGTTATAGAGTTCCCTTCCAATAGATTCATTCTCGGCAAT
AGCAAAATAGGCCAACATAGGGCAATGCCCAATATACGAGGCATAGCTAT
CACGCTGAATGTTCACAGCCCATTCAAATCTGATCAAATCACCATGGCCA
GTACCAACGGATTTGGCTTGCAAATGCTCTAGCTGGGAGTTTATATTAGA
CCTATCACTCACCTGCATTTTAGCTGGGCTTTTTA
back to top