CF835923

Overview
NameCF835923
Unique NameCF835923
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length759
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7838 contig Csv1_Contig7838:395..1153. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835923 vs. ExPASy Swiss-Prot
Match: TBA_PRUDU (Tubulin alpha chain OS=Prunus dulcis GN=TUBA PE=2 SV=1)

HSP 1 Score: 468.389 bits (1204), Expect = 1.882e-131
Identity = 234/252 (92.86%), Postives = 235/252 (93.25%), Query Frame = 2
Query:    2 ANNFSRGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAVXXXXXXXXXXXXXXXXXVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGF 757
            ANNF+RGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV                 VDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGF
Sbjct:  100 ANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGF 351          
BLAST of CF835923 vs. ExPASy Swiss-Prot
Match: TBA4_GOSHI (Tubulin alpha-4 chain OS=Gossypium hirsutum PE=2 SV=1)

HSP 1 Score: 468.389 bits (1204), Expect = 1.882e-131
Identity = 234/252 (92.86%), Postives = 235/252 (93.25%), Query Frame = 2
Query:    2 ANNFSRGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAVXXXXXXXXXXXXXXXXXVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGF 757
            ANNF+RGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV                 VDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGF
Sbjct:  100 ANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGF 351          
BLAST of CF835923 vs. ExPASy Swiss-Prot
Match: TBA1_PEA (Tubulin alpha-1 chain OS=Pisum sativum GN=TUBA1 PE=3 SV=1)

HSP 1 Score: 468.389 bits (1204), Expect = 1.882e-131
Identity = 234/252 (92.86%), Postives = 235/252 (93.25%), Query Frame = 2
Query:    2 ANNFSRGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAVXXXXXXXXXXXXXXXXXVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGF 757
            ANNF+RGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV                 VDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGF
Sbjct:  100 ANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGF 351          
BLAST of CF835923 vs. ExPASy Swiss-Prot
Match: TBA2_GOSHI (Tubulin alpha-2 chain OS=Gossypium hirsutum PE=2 SV=1)

HSP 1 Score: 466.848 bits (1200), Expect = 5.477e-131
Identity = 233/252 (92.46%), Postives = 235/252 (93.25%), Query Frame = 2
Query:    2 ANNFSRGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAVXXXXXXXXXXXXXXXXXVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGF 757
            ANNF+RGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV                 VDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVA+IKTKRTIQFVDWCPTGF
Sbjct:  100 ANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVASIKTKRTIQFVDWCPTGF 351          
BLAST of CF835923 vs. ExPASy Swiss-Prot
Match: TBA3_HORVU (Tubulin alpha-3 chain OS=Hordeum vulgare GN=TUBA3 PE=2 SV=1)

HSP 1 Score: 466.463 bits (1199), Expect = 7.153e-131
Identity = 233/252 (92.46%), Postives = 234/252 (92.86%), Query Frame = 2
Query:    2 ANNFSRGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAVXXXXXXXXXXXXXXXXXVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGF 757
            ANNF+RGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV                 VDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGF
Sbjct:  100 ANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGF 351          
BLAST of CF835923 vs. ExPASy Swiss-Prot
Match: TBA2_ORYSJ (Tubulin alpha-2 chain OS=Oryza sativa subsp. japonica GN=TUBA PE=2 SV=1)

HSP 1 Score: 466.463 bits (1199), Expect = 7.153e-131
Identity = 233/252 (92.46%), Postives = 234/252 (92.86%), Query Frame = 2
Query:    2 ANNFSRGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAVXXXXXXXXXXXXXXXXXVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGF 757
            ANNF+RGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV                 VDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGF
Sbjct:  100 ANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGF 351          
BLAST of CF835923 vs. ExPASy Swiss-Prot
Match: TBA1_ELEIN (Tubulin alpha-1 chain OS=Eleusine indica GN=TUBA1 PE=2 SV=1)

HSP 1 Score: 466.463 bits (1199), Expect = 7.153e-131
Identity = 233/252 (92.46%), Postives = 234/252 (92.86%), Query Frame = 2
Query:    2 ANNFSRGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAVXXXXXXXXXXXXXXXXXVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGF 757
            ANNF+RGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV                 VDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGF
Sbjct:  100 ANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGF 351          
BLAST of CF835923 vs. ExPASy Swiss-Prot
Match: TBA2_MAIZE (Tubulin alpha-2 chain OS=Zea mays GN=TUBA2 PE=3 SV=1)

HSP 1 Score: 466.077 bits (1198), Expect = 9.342e-131
Identity = 232/252 (92.06%), Postives = 234/252 (92.86%), Query Frame = 2
Query:    2 ANNFSRGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAVXXXXXXXXXXXXXXXXXVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGF 757
            ANNF+RGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV                 VDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVA+LLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGF
Sbjct:  100 ANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAILLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGF 351          
BLAST of CF835923 vs. ExPASy Swiss-Prot
Match: TBA1_MAIZE (Tubulin alpha-1 chain OS=Zea mays GN=TUBA1 PE=3 SV=1)

HSP 1 Score: 466.077 bits (1198), Expect = 9.342e-131
Identity = 232/252 (92.06%), Postives = 234/252 (92.86%), Query Frame = 2
Query:    2 ANNFSRGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAVXXXXXXXXXXXXXXXXXVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGF 757
            ANNF+RGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV                 VDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVA+LLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGF
Sbjct:  100 ANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAILLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGF 351          
BLAST of CF835923 vs. ExPASy Swiss-Prot
Match: TBA_DAUCA (Tubulin alpha chain OS=Daucus carota GN=TBA PE=2 SV=1)

HSP 1 Score: 464.151 bits (1193), Expect = 3.550e-130
Identity = 230/252 (91.27%), Postives = 234/252 (92.86%), Query Frame = 2
Query:    2 ANNFSRGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAVXXXXXXXXXXXXXXXXXVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGF 757
            ANNF+RGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAV                 VDYGKKSKLGFTVYPSPQ+STSVVEPYNSVLSTHSLLEHTDV+VLLDNEAIYDIC+RSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAV TIKTKRTIQFVDWCPTGF
Sbjct:  100 ANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQISTSVVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICKRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGF 351          
The following BLAST results are available for this feature:
BLAST of CF835923 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 421
Match NameE-valueIdentityDescription
TBA_PRUDU1.882e-13192.86Tubulin alpha chain OS=Prunus dulcis GN=TUBA PE=2 ... [more]
TBA4_GOSHI1.882e-13192.86Tubulin alpha-4 chain OS=Gossypium hirsutum PE=2 S... [more]
TBA1_PEA1.882e-13192.86Tubulin alpha-1 chain OS=Pisum sativum GN=TUBA1 PE... [more]
TBA2_GOSHI5.477e-13192.46Tubulin alpha-2 chain OS=Gossypium hirsutum PE=2 S... [more]
TBA3_HORVU7.153e-13192.46Tubulin alpha-3 chain OS=Hordeum vulgare GN=TUBA3 ... [more]
TBA2_ORYSJ7.153e-13192.46Tubulin alpha-2 chain OS=Oryza sativa subsp. japon... [more]
TBA1_ELEIN7.153e-13192.46Tubulin alpha-1 chain OS=Eleusine indica GN=TUBA1 ... [more]
TBA2_MAIZE9.342e-13192.06Tubulin alpha-2 chain OS=Zea mays GN=TUBA2 PE=3 SV... [more]
TBA1_MAIZE9.342e-13192.06Tubulin alpha-1 chain OS=Zea mays GN=TUBA1 PE=3 SV... [more]
TBA_DAUCA3.550e-13091.27Tubulin alpha chain OS=Daucus carota GN=TBA PE=2 S... [more]

Pages

back to top
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS03_02C03_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa02C03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835923 ID=CF835923|Name=CF835923|organism=Citrus sinensis|type=EST|length=759bp
TGCCAACAACTTCTCTCGTGGCCACTATACCATTGGTAAGGAGATTGTTG
ATCTCTGCCTTGACCGCATCAGGAAGCTGGCTGATAACTGCACTGGTCTC
CAGGGATTCCTTGTTTTCAATGCTGTTGGTGGAGGAACTGGCTCTGGTCT
TGGGTCTCTTCTTCTGGAGAGGTTGTCTGTTGACTATGGAAAGAAGTCAA
AGTTGGGCTTCACTGTCTACCCATCTCCTCAGGTCTCCACATCTGTTGTT
GAGCCTTACAACAGTGTCCTCTCAACCCACTCCCTGTTGGAGCATACTGA
TGTGGCTGTTCTTCTCGACAATGAGGCCATTTATGACATCTGCAGGCGCT
CCCTTGACATTGAACGTCCTACCTATACTAACCTCAATAGACTTGTTTCT
CAGGTAATTTCTTCATTGACTGCCTCACTGAGGTTTGATGGTGCTTTGAA
TGTGGATGTGACTGAATTCCAAACCAACTTGGTCCCATACCCAAGAATCC
ACTTCATGCTTTCCTCCTATGCACCAGTCATCTCAGCTGAGAAGGCCTAC
CATGAACAACTCTCAGTTGCTGAGATCACCAACAGTGCCTTTGAGCCCTC
ATCTATGATGGCCAAATGTGATCCTCGTCATGGCAAGTACATGGCTTGCT
GCCTTATGTACCGCGGTGATGTTGTGCCCAAGGATGTCAATGCAGCTGTT
GCTACCATCAAGACCAAGCGTACAATCCAATTCGTCGACTGGTGCCCGAC
TGGGTTCAA
back to top