CF836727
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF836727 vs. ExPASy Swiss-Prot
Match: RPT3_ARATH (Root phototropism protein 3 OS=Arabidopsis thaliana GN=RPT3 PE=1 SV=1) HSP 1 Score: 82.8037 bits (203), Expect = 2.047e-15 Identity = 38/54 (70.37%), Postives = 47/54 (87.04%), Query Frame = -2 Query: 563 HPDLNKCERKRLCRILDCKKLSMEACMHAARNELLPLRVVVQVLFFEQARATMA 724 HP L++ ERKRLCR++DC+KLSM+ACMHAA+NE LPLRVVVQVLF EQ + + A Sbjct: 555 HPTLSEHERKRLCRVMDCQKLSMDACMHAAQNERLPLRVVVQVLFSEQVKISNA 608
BLAST of CF836727 vs. ExPASy Swiss-Prot
Match: NPH3_ORYSJ (Coleoptile phototropism protein 1 OS=Oryza sativa subsp. japonica GN=CPT1 PE=2 SV=1) HSP 1 Score: 80.4925 bits (197), Expect = 1.016e-14 Identity = 37/54 (68.52%), Postives = 45/54 (83.33%), Query Frame = -2 Query: 563 HPDLNKCERKRLCRILDCKKLSMEACMHAARNELLPLRVVVQVLFFEQARATMA 724 HP L + ERKRLCR++DC+KLS +ACMHAA+NE LPLRVVVQVLF EQ + + A Sbjct: 558 HPTLTEHERKRLCRVMDCQKLSFDACMHAAQNERLPLRVVVQVLFTEQVKISNA 611
BLAST of CF836727 vs. ExPASy Swiss-Prot
Match: Y1044_ARATH (BTB/POZ domain-containing protein At1g30440 OS=Arabidopsis thaliana GN=At1g30440 PE=1 SV=2) HSP 1 Score: 77.7962 bits (190), Expect = 6.586e-14 Identity = 37/57 (64.91%), Postives = 47/57 (82.46%), Query Frame = -2 Query: 560 HPDLNKCERKRLCRILDCKKLSMEACMHAARNELLPLRVVVQVLFFE--QARATMAG 724 HP L + ER+ LCR+LDC+KLS+EAC HAA+NE LPLR++VQVLFFE Q R ++AG Sbjct: 459 HPWLAETERENLCRLLDCQKLSLEACTHAAQNERLPLRIIVQVLFFEQLQLRTSVAG 515 The following BLAST results are available for this feature:
BLAST of CF836727 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CF836727 ID=CF836727; Name=CF836727; organism=Citrus sinensis; type=EST; length=725bpback to top |