CF972318

Overview
NameCF972318
Unique NameCF972318
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length723
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3822 contig Csv1_Contig3822:137..859. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF972318 vs. ExPASy Swiss-Prot
Match: LDOX_MALDO (Leucoanthocyanidin dioxygenase OS=Malus domestica GN=ANS PE=2 SV=1)

HSP 1 Score: 380.563 bits (976), Expect = 4.713e-105
Identity = 179/240 (74.58%), Postives = 205/240 (85.42%), Query Frame = 2
Query:    2 EGPQVPTIDLKEIDSEDRVEREKCREELKKAAMDWGVMHLVNHGISDDLTERVKRAGQAFFDQPVEEKEKYANEQASGKIQGYGSKLANNASGQLEWEDYFFHLIYPEDKRDMSIWPKTPSDYTEATSEYARQLRSLATKILAVXXXXXXXXXXXXXXXXXXXXXXXXQMKINYYPKCPQPELALGVEAHTDVSALTFILHNMVPGLQLFYKDKWVTAKCVPNSIILHIGDTIEILSNGE 721
            EGPQVPTIDLKEI+S++   R KCRE+LKKAA+DWGVMHLVNHGISD+L ++V++AG+AFFD P+E+KEKYAN+QASGKIQGYGSKLANNASGQLEWEDYFFH +YPEDKRD+SIWP+TP+DY EAT+EYA+QLR LATK+L V                        QMKINYYPKCPQPELALGVEAHTDVSALTFILHNMVPGLQLFY+ KWVTAKCVPNSI++HIGDT+EILSNG+
Sbjct:   47 EGPQVPTIDLKEIESDNEKVRAKCREKLKKAAVDWGVMHLVNHGISDELMDKVRKAGKAFFDLPIEQKEKYANDQASGKIQGYGSKLANNASGQLEWEDYFFHCVYPEDKRDLSIWPQTPADYIEATAEYAKQLRELATKVLKVLSLGLGLDEGRLEKEVGGLEELLLQMKINYYPKCPQPELALGVEAHTDVSALTFILHNMVPGLQLFYEGKWVTAKCVPNSIVMHIGDTLEILSNGK 286          
BLAST of CF972318 vs. ExPASy Swiss-Prot
Match: LDOX_VITVI (Leucoanthocyanidin dioxygenase OS=Vitis vinifera PE=2 SV=1)

HSP 1 Score: 375.555 bits (963), Expect = 1.516e-103
Identity = 186/244 (76.23%), Postives = 202/244 (82.79%), Query Frame = 2
Query:    2 EGPQVPTIDLKEIDSEDRVER----EKCREELKKAAMDWGVMHLVNHGISDDLTERVKRAGQAFFDQPVEEKEKYANEQASGKIQGYGSKLANNASGQLEWEDYFFHLIYPEDKRDMSIWPKTPSDYTEATSEYARQLRSLATKILAVXXXXXXXXXXXXXXXXXXXXXXXXQMKINYYPKCPQPELALGVEAHTDVSALTFILHNMVPGLQLFYKDKWVTAKCVPNSIILHIGDTIEILSNGE 721
            EGPQVPTIDLK+I+SED V R    E+CREELKKAAM+WGVMHLVNHGISDDL  RVK AG+ FF+ P+EEKEKYAN+QASGKI GYGSKLANNASGQLEWEDYFFHLI+PEDKRDM+IWPKTPSDY  AT EY+ +LRSLATKIL+V                        Q KINYYPKCPQPELALGVEAHTDVSALTFILHNMVPGLQLFY+ KWVTAKCVPNSII+HIGDTIEILSNG+
Sbjct:   45 EGPQVPTIDLKDIESEDEVVRREIRERCREELKKAAMEWGVMHLVNHGISDDLINRVKVAGETFFNLPMEEKEKYANDQASGKIAGYGSKLANNASGQLEWEDYFFHLIFPEDKRDMTIWPKTPSDYVPATCEYSVKLRSLATKILSVLSLGLGLEEGRLEKEVGGMEELLLQKKINYYPKCPQPELALGVEAHTDVSALTFILHNMVPGLQLFYEGKWVTAKCVPNSIIMHIGDTIEILSNGK 288          
BLAST of CF972318 vs. ExPASy Swiss-Prot
Match: LDOX_PETHY (Leucoanthocyanidin dioxygenase OS=Petunia hybrida GN=ANT17 PE=2 SV=1)

HSP 1 Score: 372.859 bits (956), Expect = 9.827e-103
Identity = 181/240 (75.42%), Postives = 200/240 (83.33%), Query Frame = 2
Query:    2 EGPQVPTIDLKEIDSEDRVEREKCREELKKAAMDWGVMHLVNHGISDDLTERVKRAGQAFFDQPVEEKEKYANEQASGKIQGYGSKLANNASGQLEWEDYFFHLIYPEDKRDMSIWPKTPSDYTEATSEYARQLRSLATKILAVXXXXXXXXXXXXXXXXXXXXXXXXQMKINYYPKCPQPELALGVEAHTDVSALTFILHNMVPGLQLFYKDKWVTAKCVPNSIILHIGDTIEILSNGE 721
            EGPQVPTIDLKEIDSED+  REKC + LKKAAM+WGVMHLVNHGISD+L  RVK AG+ FFDQPVEEKEKYAN+QA+G +QGYGSKLAN+A GQLEWEDYFFH  +PEDKRD+SIWPK P+DYT ATSEYA+Q+R+LATKIL V                        QMKINYYPKCPQPELALGVEAHTDVSALTFILHNMVPGLQLFY+ +WVTAKCVPNSII+HIGDTIEILSNG+
Sbjct:   48 EGPQVPTIDLKEIDSEDKEIREKCHQ-LKKAAMEWGVMHLVNHGISDELINRVKVAGETFFDQPVEEKEKYANDQANGNVQGYGSKLANSACGQLEWEDYFFHCAFPEDKRDLSIWPKNPTDYTPATSEYAKQIRALATKILTVLSIGLGLEEGRLEKEVGGMEDLLLQMKINYYPKCPQPELALGVEAHTDVSALTFILHNMVPGLQLFYEGQWVTAKCVPNSIIMHIGDTIEILSNGK 286          
BLAST of CF972318 vs. ExPASy Swiss-Prot
Match: LDOX_ARATH (Leucoanthocyanidin dioxygenase OS=Arabidopsis thaliana GN=LDOX PE=1 SV=1)

HSP 1 Score: 363.999 bits (933), Expect = 4.565e-100
Identity = 175/240 (72.92%), Postives = 195/240 (81.25%), Query Frame = 2
Query:    2 EGPQVPTIDLKEIDSEDRVEREKCREELKKAAMDWGVMHLVNHGISDDLTERVKRAGQAFFDQPVEEKEKYANEQASGKIQGYGSKLANNASGQLEWEDYFFHLIYPEDKRDMSIWPKTPSDYTEATSEYARQLRSLATKILAVXXXXXXXXXXXXXXXXXXXXXXXXQMKINYYPKCPQPELALGVEAHTDVSALTFILHNMVPGLQLFYKDKWVTAKCVPNSIILHIGDTIEILSNGE 721
            +GPQVPTIDLK I+S+D   RE C EELKKA++DWGVMHL+NHGI  DL ERVK+AG+ FF   VEEKEKYAN+QA+GKIQGYGSKLANNASGQLEWEDYFFHL YPE+KRD+SIWPKTPSDY EATSEYA+ LR LATK+                           QMKINYYPKCPQPELALGVEAHTDVSALTFILHNMVPGLQLFY+ KWVTAKCVP+SI++HIGDT+EILSNG+
Sbjct:   43 DGPQVPTIDLKNIESDDEKIRENCIEELKKASLDWGVMHLINHGIPADLMERVKKAGEEFFSLSVEEKEKYANDQATGKIQGYGSKLANNASGQLEWEDYFFHLAYPEEKRDLSIWPKTPSDYIEATSEYAKCLRLLATKVFKALSVGLGLEPDRLEKEVGGLEELLLQMKINYYPKCPQPELALGVEAHTDVSALTFILHNMVPGLQLFYEGKWVTAKCVPDSIVMHIGDTLEILSNGK 282          
BLAST of CF972318 vs. ExPASy Swiss-Prot
Match: LDOX_PERFR (Leucoanthocyanidin dioxygenase OS=Perilla frutescens GN=ANS PE=2 SV=1)

HSP 1 Score: 358.992 bits (920), Expect = 1.468e-98
Identity = 171/240 (71.25%), Postives = 194/240 (80.83%), Query Frame = 2
Query:    2 EGPQVPTIDLKEIDSEDRVEREKCREELKKAAMDWGVMHLVNHGISDDLTERVKRAGQAFFDQPVEEKEKYANEQASGKIQGYGSKLANNASGQLEWEDYFFHLIYPEDKRDMSIWPKTPSDYTEATSEYARQLRSLATKILAVXXXXXXXXXXXXXXXXXXXXXXXXQMKINYYPKCPQPELALGVEAHTDVSALTFILHNMVPGLQLFYKDKWVTAKCVPNSIILHIGDTIEILSNGE 721
            EGPQ+PTIDL+E+DS D   R+KC EELKKAA DWGVMHL+NHGI ++L +RVK AG+ FF+ PVEEKE YAN+QA+G +QGYGSKLANNASGQLEWEDYFFH +YPE K D+SIWP  P DY  ATSEYA+QLR+LATKIL+V                        QMKIN+YPKCPQPELALG EAHTDVSALTFILHNMVPGLQLFY+DKWVTAKCVPNSII+HIGDT+EILSNG+
Sbjct:   49 EGPQLPTIDLEEMDSRDEEGRKKCHEELKKAATDWGVMHLINHGIPEELIDRVKAAGKEFFELPVEEKEAYANDQAAGNVQGYGSKLANNASGQLEWEDYFFHCVYPEHKTDLSIWPTKPPDYIPATSEYAKQLRALATKILSVLSIGLGLEKGRLEKEVGGAEDLIVQMKINFYPKCPQPELALGWEAHTDVSALTFILHNMVPGLQLFYEDKWVTAKCVPNSIIMHIGDTLEILSNGK 288          
BLAST of CF972318 vs. ExPASy Swiss-Prot
Match: LDOX_MAIZE (Leucoanthocyanidin dioxygenase OS=Zea mays GN=A2 PE=2 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 1.639e-65
Identity = 118/248 (47.58%), Postives = 163/248 (65.73%), Query Frame = 2
Query:    8 PQVPTIDLKEI--DSEDRVEREKCREELKKAAMDWGVMHLVNHGISDDLTERVKRAGQAFFDQPVEEKEKYANEQASGKIQGYGSKLANNASGQLEWEDYFFHLIYPEDKRDMSIWPKTPSDYTEATSEYARQLRSLATKILAV---------XXXXXXXXXXXXXXXXXXXXXXXXQMKINYYPKCPQPELALGVEAHTDVSALTFILHNMVPGLQLFYKDKWVTAKCVPNSIILHIGDTIEILSNG 718
            P++P +D+      S  + +R++C E ++ AA DWGVMH+  HGI  +L +R++ AG AFF  PV++KE YAN+ A+G++QGYGS+LA N  GQ EWEDY FHL++P+   D ++WP  P DY  AT ++ R+ R LA+ +LA+                                 Q+KINYYP+CPQPELA+GVEAHTDVSAL+FILHN VPGLQ+ +  +WVTA+  P +II+H+GD +EILSNG
Sbjct:   56 PRIPVVDISPFLDSSSQQQQRDECVEAVRAAAADWGVMHIAGHGIPAELMDRLRAAGTAFFALPVQDKEAYANDPAAGRLQGYGSRLATNTCGQREWEDYLFHLVHPDGLADHALWPAYPPDYIAATRDFGRRTRDLASTLLAILSMGLLGTDRGDALEKALTTTTTRTAADDDLLLQLKINYYPRCPQPELAVGVEAHTDVSALSFILHNGVPGLQVLHGARWVTARHEPGTIIVHVGDALEILSNG 303          
BLAST of CF972318 vs. ExPASy Swiss-Prot
Match: FLS_CITUN (Flavonol synthase/flavanone 3-hydroxylase OS=Citrus unshiu GN=FLS PE=1 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 5.658e-50
Identity = 95/238 (39.92%), Postives = 139/238 (58.40%), Query Frame = 2
Query:    8 PQVPTIDLKEIDSEDRVEREKCREELKKAAMDWGVMHLVNHGISDDLTERVKRAGQAFFDQPVEEKEKYANEQASGKIQGYGSKLANNASGQLEWEDYFFHLIYPEDKRDMSIWPKTPSDYTEATSEYARQLRSLATKILAVXXXXXXXXXXXXXXXXXXXXXXXXQMKINYYPKCPQPELALGVEAHTDVSALTFILHNMVPGLQLFYKDKWVTAKCVPNSIILHIGDTIEILSNGE 721
            P++PTIDL +   +DR+ R      + +A+ +WG+  + NHGI  DL  +++  G+ FF+ P EEKE Y+    +  +QGYG+KL     G+  W D+ FH ++P    +   WPK P  Y     EYA+ +R +  K+                            +KINYYP CP+P+LALGV AHTD+SALT ++ N VPGLQ+F  D+W+ AK +PN++++HIGD IEILSNG+
Sbjct:   41 PEIPTIDLDD-PVQDRLVRS-----IAEASREWGIFQVTNHGIPSDLICKLQAVGKEFFELPQEEKEVYSRPADAKDVQGYGTKLQKEVEGKKSWVDHLFHRVWPPSSINYRFWPKNPPSYRAVNEEYAKYMREVVDKLFTYLSLGLGVEGGVLKEAAGGDDIEY-MLKINYYPPCPRPDLALGVVAHTDLSALTVLVPNEVPGLQVFKDDRWIDAKYIPNALVIHIGDQIEILSNGK 271          
BLAST of CF972318 vs. ExPASy Swiss-Prot
Match: FLS1_ARATH (Flavonol synthase/flavanone 3-hydroxylase OS=Arabidopsis thaliana GN=FLS1 PE=1 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 1.304e-46
Identity = 93/237 (39.24%), Postives = 133/237 (56.12%), Query Frame = 2
Query:    8 PQVPTIDLKEIDSEDRVEREKCREELKKAAMDWGVMHLVNHGISDDLTERVKRAGQAFFDQPVEEKEKYANEQASGKIQGYGSKLANNASGQLEWEDYFFHLIYPEDKRDMSIWPKTPSDYTEATSEYARQLRSLATKILAVXXXXXXXXXXXXXXXXXXXXXXXXQMKINYYPKCPQPELALGVEAHTDVSALTFILHNMVPGLQLFYKDKWVTAKCVPNSIILHIGDTIEILSNG 718
            P +P +DL + D E        R  + KA+ +WG+  +VNHGI  +L  R++  G+ FF+ P  EKE  A  + S  I+GYG+KL  +  G+  W D+ FH I+P    +   WPK P +Y E   EYA  ++ L+  +L +                         MKINYYP CP+P+LALGV AHTD+S +T ++ N VPGLQ+F  D W  A+ +P+++I+HIGD I  LSNG
Sbjct:   41 PAIPVVDLSDPDEES------VRRAVVKASEEWGLFQVVNHGIPTELIRRLQDVGRKFFELPSSEKESVAKPEDSKDIEGYGTKLQKDPEGKKAWVDHLFHRIWPPSCVNYRFWPKNPPEYREVNEEYAVHVKKLSETLLGI-LSDGLGLKRDALKEGLGGEMAEYMMKINYYPPCPRPDLALGVPAHTDLSGITLLVPNEVPGLQVFKDDHWFDAEYIPSAVIVHIGDQILRLSNG 270          
BLAST of CF972318 vs. ExPASy Swiss-Prot
Match: FLS_PETCR (Flavonol synthase/flavanone 3-hydroxylase OS=Petroselinum crispum GN=FLS PE=1 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 2.906e-46
Identity = 92/237 (38.82%), Postives = 135/237 (56.96%), Query Frame = 2
Query:   11 QVPTIDLKEIDSEDRVEREKCREELKKAAMDWGVMHLVNHGISDDLTERVKRAGQAFFDQPVEEKEKYANEQASGKIQGYGSKLANNASGQLEWEDYFFHLIYPEDKRDMSIWPKTPSDYTEATSEYARQLRSLATKILAVXXXXXXXXXXXXXXXXXXXXXXXXQMKINYYPKCPQPELALGVEAHTDVSALTFILHNMVPGLQLFYKDKWVTAKCVPNSIILHIGDTIEILSNGE 721
            QVP IDL   ++ +    E   E + +A+ +WG+  +VNHGI DD   ++++ G+ FF+ P +EKE  A  +    ++GYG+KL     G+  W D+ FH+I+P+   + + WP  P  Y EA  EYA  LR +  K+                            +KINYYP CP+P+LALGV AHTD+SA+T ++ N V GLQ+   D W   K +PN++I+HIGD IEI+SNG+
Sbjct:   42 QVPVIDLGSSNNTE----ENLVELIAEASREWGIFQVVNHGIPDDAIAKLQKVGKEFFELPQQEKEVIAKPEGYQGVEGYGTKLQKELGGKKGWVDHLFHIIWPKSAVNYNFWPNNPPLYREANEEYAVALRGVVDKLFEA-LSLGIGLEKHELKKASGGDDLIYMLKINYYPPCPRPDLALGVVAHTDMSAITILVPNEVQGLQVHKDDHWYDVKYIPNALIIHIGDQIEIMSNGK 273          
BLAST of CF972318 vs. ExPASy Swiss-Prot
Match: FLS_EUSGR (Flavonol synthase/flavanone 3-hydroxylase OS=Eustoma grandiflorum GN=FLS PE=2 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 1.221e-44
Identity = 92/237 (38.82%), Postives = 135/237 (56.96%), Query Frame = 2
Query:   11 QVPTIDLKEIDSEDRVEREKCREELKKAAMDWGVMHLVNHGISDDLTERVKRAGQAFFDQPVEEKEKYANEQASGKIQGYGSKLANNASGQLEWEDYFFHLIYPEDKRDMSIWPKTPSDYTEATSEYARQLRSLATKILAVXXXXXXXXXXXXXXXXXXXXXXXXQMKINYYPKCPQPELALGVEAHTDVSALTFILHNMVPGLQLFYKDKWVTAKCVPNSIILHIGDTIEILSNGE 721
            +VP IDL + D +  V        + +A+ +WG+  +VNHGI +++  +++  G+ FF+ P EEKE  A  + S  I+GYG++L     G+  W D+ FH I+P    +   WPK P  Y EA  EYA++L+ L    L                           MKINYYP CP+P+LALGV AHTD+SA+T ++ N VPGLQ++    W   K +PN++I+HIGD +EI+SNG+
Sbjct:   42 EVPVIDLSDSDEKKIVGL------VSEASKEWGIFQVVNHGIPNEVIRKLQEVGKHFFELPQEEKELIAKPEGSQSIEGYGTRLQKEVDGKKGWVDHLFHKIWPPSAINYQFWPKNPPAYREANEEYAKRLQ-LVVDNLFKYLSLGLDLEPNSFKDGAGGDDLVYLMKINYYPPCPRPDLALGV-AHTDMSAITVLVPNEVPGLQVYKDGHWYDCKYIPNALIVHIGDQVEIMSNGK 270          
The following BLAST results are available for this feature:
BLAST of CF972318 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 82
Match NameE-valueIdentityDescription
LDOX_MALDO4.713e-10574.58Leucoanthocyanidin dioxygenase OS=Malus domestica ... [more]
LDOX_VITVI1.516e-10376.23Leucoanthocyanidin dioxygenase OS=Vitis vinifera P... [more]
LDOX_PETHY9.827e-10375.42Leucoanthocyanidin dioxygenase OS=Petunia hybrida ... [more]
LDOX_ARATH4.565e-10072.92Leucoanthocyanidin dioxygenase OS=Arabidopsis thal... [more]
LDOX_PERFR1.468e-9871.25Leucoanthocyanidin dioxygenase OS=Perilla frutesce... [more]
LDOX_MAIZE1.639e-6547.58Leucoanthocyanidin dioxygenase OS=Zea mays GN=A2 P... [more]
FLS_CITUN5.658e-5039.92Flavonol synthase/flavanone 3-hydroxylase OS=Citru... [more]
FLS1_ARATH1.304e-4639.24Flavonol synthase/flavanone 3-hydroxylase OS=Arabi... [more]
FLS_PETCR2.906e-4638.82Flavonol synthase/flavanone 3-hydroxylase OS=Petro... [more]
FLS_EUSGR1.221e-4438.82Flavonol synthase/flavanone 3-hydroxylase OS=Eusto... [more]

Pages

back to top
Libraries
Library NameType
sweet orange flesh cDNAcdna_library
Properties
Property NameValue
Genbank descriptionANS-partial sweet orange flesh cDNA Citrus sinensis cDNA similar to partial anthocyanidin synthase, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF972318 ID=CF972318|Name=CF972318|organism=Citrus sinensis|type=EST|length=723bp
TGAAGGGCCTCAAGTTCCCACAATTGATCTCAAGGAAATTGACTCTGAGG
ACAGAGTTGAACGCGAGAAATGTCGCGAGGAGCTCAAGAAAGCTGCCATG
GATTGGGGTGTTATGCACCTTGTTAACCATGGGATTTCGGATGATCTCAC
TGAACGCGTCAAGAGAGCCGGTCAGGCCTTTTTCGATCAGCCGGTTGAGG
AGAAAGAGAAGTATGCCAATGAGCAGGCTTCGGGAAAGATTCAGGGTTAC
GGAAGCAAGCTAGCTAATAATGCTAGTGGCCAGCTTGAGTGGGAGGACTA
TTTCTTCCACCTTATTTATCCTGAAGATAAAAGGGATATGTCCATTTGGC
CTAAGACTCCAAGCGACTATACAGAGGCTACCAGTGAATACGCAAGGCAA
CTGAGAAGCCTAGCGACGAAAATTCTGGCAGTGTTGTCACTTGGCTTGGG
ACTGGAAGAGGGGAGGCTGGAAAAGGAAGTTGGTGGCCTAGAAGAGCTCC
TTCTTCAGATGAAGATCAATTACTATCCCAAATGCCCTCAACCAGAACTG
GCTCTTGGTGTTGAAGCTCACACAGATGTGAGTGCACTCACTTTCATTCT
TCACAACATGGTTCCGGGCCTGCAGCTCTTCTACAAAGACAAATGGGTGA
CTGCTAAATGTGTTCCAAATTCGATCATCTTGCACATTGGTGACACCATT
GAAATTCTGAGCAATGGCGAGTA
back to top