CK740131

Overview
NameCK740131
Unique NameCK740131
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length362
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2799 contig Csv1_Contig2799:449..810. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK740131 vs. ExPASy Swiss-Prot
Match: IF5A2_NICPL (Eukaryotic translation initiation factor 5A-2 OS=Nicotiana plumbaginifolia GN=EIF-5A2 PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 1.784e-12
Identity = 33/37 (89.19%), Postives = 37/37 (100.00%), Query Frame = 1
Query:    4 LLTQLKDGFAEGKDLVLTVMSSMGEEQICALKDIGPK 114
            LLTQ+KDGFAEGKDLV++VMS+MGEEQICALKDIGPK
Sbjct:  123 LLTQIKDGFAEGKDLVVSVMSAMGEEQICALKDIGPK 159          
BLAST of CK740131 vs. ExPASy Swiss-Prot
Match: IF5A2_MEDSA (Eukaryotic translation initiation factor 5A-2 OS=Medicago sativa PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 3.042e-12
Identity = 32/38 (84.21%), Postives = 38/38 (100.00%), Query Frame = 1
Query:    1 TLLTQLKDGFAEGKDLVLTVMSSMGEEQICALKDIGPK 114
            +LLTQ+KDGFA+GKDLV++VMS+MGEEQICALKDIGPK
Sbjct:  122 SLLTQIKDGFADGKDLVVSVMSAMGEEQICALKDIGPK 159          
BLAST of CK740131 vs. ExPASy Swiss-Prot
Match: IF5A_SENVE (Eukaryotic translation initiation factor 5A OS=Senecio vernalis GN=EIFSV1 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 5.190e-12
Identity = 32/37 (86.49%), Postives = 36/37 (97.30%), Query Frame = 1
Query:    4 LLTQLKDGFAEGKDLVLTVMSSMGEEQICALKDIGPK 114
            LLTQ+KDGF EGKDLV++VMS+MGEEQICALKDIGPK
Sbjct:  123 LLTQIKDGFGEGKDLVVSVMSAMGEEQICALKDIGPK 159          
BLAST of CK740131 vs. ExPASy Swiss-Prot
Match: IF5A5_SOLTU (Eukaryotic translation initiation factor 5A-5 OS=Solanum tuberosum GN=EIF5A5 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 5.190e-12
Identity = 32/38 (84.21%), Postives = 36/38 (94.74%), Query Frame = 1
Query:    1 TLLTQLKDGFAEGKDLVLTVMSSMGEEQICALKDIGPK 114
            TLL Q+KDGFAEGKDLVL+VMS+MGEEQIC +KDIGPK
Sbjct:  122 TLLAQVKDGFAEGKDLVLSVMSAMGEEQICGIKDIGPK 159          
BLAST of CK740131 vs. ExPASy Swiss-Prot
Match: IF5A1_SOLLC (Eukaryotic translation initiation factor 5A-1 OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 5.190e-12
Identity = 32/38 (84.21%), Postives = 36/38 (94.74%), Query Frame = 1
Query:    1 TLLTQLKDGFAEGKDLVLTVMSSMGEEQICALKDIGPK 114
            TLL Q+KDGFAEGKDLVL+VMS+MGEEQIC +KDIGPK
Sbjct:  122 TLLAQVKDGFAEGKDLVLSVMSAMGEEQICGIKDIGPK 159          
BLAST of CK740131 vs. ExPASy Swiss-Prot
Match: IF5A1_MEDSA (Eukaryotic translation initiation factor 5A-1 OS=Medicago sativa PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 1.156e-11
Identity = 32/39 (82.05%), Postives = 38/39 (97.44%), Query Frame = 1
Query:    1 TLLTQLKDGFAEGKDLVLTVMSSMGEEQICALKDIGPKS 117
            +LLTQ+KDGFAEGKDLV++VMS+MGEEQICALKDIG K+
Sbjct:  123 SLLTQIKDGFAEGKDLVVSVMSAMGEEQICALKDIGGKN 161          
BLAST of CK740131 vs. ExPASy Swiss-Prot
Match: IF5A_MANES (Eukaryotic translation initiation factor 5A OS=Manihot esculenta PE=2 SV=2)

HSP 1 Score: 67.3958 bits (163), Expect = 2.576e-11
Identity = 30/38 (78.95%), Postives = 38/38 (100.00%), Query Frame = 1
Query:    4 LLTQLKDGFAEGKDLVLTVMSSMGEEQICALKDIGPKS 117
            LL+Q+KDGFAEGKDLV++VMS+MGEE+IC+LKDIGPK+
Sbjct:  123 LLSQIKDGFAEGKDLVVSVMSAMGEERICSLKDIGPKN 160          
BLAST of CK740131 vs. ExPASy Swiss-Prot
Match: IF5A4_SOLTU (Eukaryotic translation initiation factor 5A-4 OS=Solanum tuberosum GN=EIF5A4 PE=2 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 9.787e-11
Identity = 31/38 (81.58%), Postives = 37/38 (97.37%), Query Frame = 1
Query:    1 TLLTQLKDGFAEGKDLVLTVMSSMGEEQICALKDIGPK 114
            +LL+Q+KDGFAEGKDLV++VMS+MGEEQI ALKDIGPK
Sbjct:  122 SLLSQIKDGFAEGKDLVVSVMSAMGEEQINALKDIGPK 159          
The following BLAST results are available for this feature:
BLAST of CK740131 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
IF5A2_NICPL1.784e-1289.19Eukaryotic translation initiation factor 5A-2 OS=N... [more]
IF5A2_MEDSA3.042e-1284.21Eukaryotic translation initiation factor 5A-2 OS=M... [more]
IF5A_SENVE5.190e-1286.49Eukaryotic translation initiation factor 5A OS=Sen... [more]
IF5A5_SOLTU5.190e-1284.21Eukaryotic translation initiation factor 5A-5 OS=S... [more]
IF5A1_SOLLC5.190e-1284.21Eukaryotic translation initiation factor 5A-1 OS=S... [more]
IF5A1_MEDSA1.156e-1182.05Eukaryotic translation initiation factor 5A-1 OS=M... [more]
IF5A_MANES2.576e-1178.95Eukaryotic translation initiation factor 5A OS=Man... [more]
IF5A4_SOLTU9.787e-1181.58Eukaryotic translation initiation factor 5A-4 OS=S... [more]
back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_6625 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone RSE65G10 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK740131 ID=CK740131|Name=CK740131|organism=Citrus sinensis|type=EST|length=362bp
ACTCTGCTGACCCAGCTCAAGGACGGTTTTGCTGAGGGGAAGGACTTGGT
TTTGACTGTCATGTCTTCAATGGGCGAGGAGCAGATCTGTGCCCTCAAGG
ATATTGGCCCAAAGTCGTAGTTGCGCGATATGTGATTATCTTCTGTGTCT
GGTTGCATCTGTTTTTTGGAAAAATATTTTAATCATCTAGAGTTTGCCTT
TAATATTTGTAGCGTCTTTGTTTTGTGGTGAGAATTGCAAGCTGCCTGGA
ATATGTAGTTCTTTTGATTGGCGGCTAAAAAATTTATGGTGTTCAATTTC
TCTAATGAATTATAATGTTAGAAAGAAATCGTCTTTGTTATTTATAAAAA
AAAAAAAAAAAA
back to top