CK740312

Overview
NameCK740312
Unique NameCK740312
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length649
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1625 contig Csv1_Contig1625:456..1105. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK740312 vs. ExPASy Swiss-Prot
Match: Y2766_ARATH (Uncharacterized protein At2g37660, chloroplastic OS=Arabidopsis thaliana GN=At2g37660 PE=1 SV=2)

HSP 1 Score: 285.034 bits (728), Expect = 1.501e-100
Identity = 136/161 (84.47%), Postives = 152/161 (94.41%), Query Frame = 1
Query:    1 VYKKLKERSEQYAARGLVRTEESKQKIGGADDLFIGDIRDSNSIIPAIQGIDALIILTSAVPKMKPDFDPAKGGRPEFYFEEGAYPEQVDWIGQKNQIDAAKAAGAKQIVLVGSMGGTNLNHPLNSLGNGNILVWKRKAEQYLADSGIPYTIIRAGGLQIK 483
            VYKKLKERSEQ+ ARGLVRT+ESK+KI G D++FIGDIRD+ SI PA++GIDAL+ILTSAVP+MKP FDP+KGGRPEF+F++GAYPEQVDWIGQKNQIDAAKAAG KQIVLVGSMGGTN+NHPLNS+GN NILVWKRKAEQYLADSGIPYTIIRAGGLQ K
Sbjct:   92 VYKKLKERSEQFVARGLVRTKESKEKINGEDEVFIGDIRDTASIAPAVEGIDALVILTSAVPQMKPGFDPSKGGRPEFFFDDGAYPEQVDWIGQKNQIDAAKAAGVKQIVLVGSMGGTNINHPLNSIGNANILVWKRKAEQYLADSGIPYTIIRAGGLQDK 252          

HSP 2 Score: 102.449 bits (254), Expect = 1.501e-100
Identity = 50/57 (87.72%), Postives = 54/57 (94.74%), Query Frame = 3
Query:  477 DKEGGIRELLVGKDDELLQTETRTIARADVAEVCIQALQFEEAQFMAFDLASKPEGT 647
            DK+GGIRELLVGKDDELL+TETRTIARADVAEVC+QALQ EEA+F A DLASKPEGT
Sbjct:  251 DKDGGIRELLVGKDDELLETETRTIARADVAEVCVQALQLEEAKFKALDLASKPEGT 307          
BLAST of CK740312 vs. ExPASy Swiss-Prot
Match: Y5224_ARATH (Uncharacterized protein At5g02240 OS=Arabidopsis thaliana GN=At5g02240 PE=1 SV=1)

HSP 1 Score: 259.996 bits (663), Expect = 1.994e-91
Identity = 126/162 (77.78%), Postives = 141/162 (87.04%), Query Frame = 1
Query:    1 VYKKLKERSEQYAARGLVRTEESKQKIGGADDLFIGDIRDSNSIIPAIQGIDALIILTSAVPKMKPDFDPAKGGRPEFYFEEGAYPEQVDWIGQKNQIDAAKAAGAKQIVLVGSMGGTNLNHPLNSLGNGNILVWKRKAEQYLADSGIPYTIIRAGGLQIKK 486
            VYKKLKE S+++ A+GLVR+ + K+KIGG  D+FIGDI D++SI PA QGIDAL+ILTSAVPKMKP FDP KGGRPEF FE+G YPEQVDWIGQKNQIDAAK AG K IV+VGSMGGTN +HPLN LGNGNILVWKRKAEQYLADSG PYTIIRAGGL  K+
Sbjct:   20 VYKKLKEGSDKFVAKGLVRSAQGKEKIGGEADVFIGDITDADSINPAFQGIDALVILTSAVPKMKPGFDPTKGGRPEFIFEDGQYPEQVDWIGQKNQIDAAKVAGVKHIVVVGSMGGTNPDHPLNKLGNGNILVWKRKAEQYLADSGTPYTIIRAGGLLDKE 181          

HSP 2 Score: 97.0561 bits (240), Expect = 1.994e-91
Identity = 47/57 (82.46%), Postives = 52/57 (91.23%), Query Frame = 3
Query:  477 DKEGGIRELLVGKDDELLQTETRTIARADVAEVCIQALQFEEAQFMAFDLASKPEGT 647
            DKEGG+RELLVGKDDELLQT+T+T+ RADVAEVCIQAL FEEA+  AFDL SKPEGT
Sbjct:  179 DKEGGVRELLVGKDDELLQTDTKTVPRADVAEVCIQALLFEEAKNKAFDLGSKPEGT 235          
The following BLAST results are available for this feature:
BLAST of CK740312 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
Y2766_ARATH1.501e-10084.47Uncharacterized protein At2g37660, chloroplastic O... [more]
Y5224_ARATH1.994e-9177.78Uncharacterized protein At5g02240 OS=Arabidopsis t... [more]
back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_6456 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone RSE63G02 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK740312 ID=CK740312|Name=CK740312|organism=Citrus sinensis|type=EST|length=649bp
GTTTATAAGAAATTAAAGGAGAGGTCAGAGCAATATGCTGCTAGAGGTTT
GGTCAGAACTGAGGAGAGCAAGCAGAAAATTGGCGGAGCTGATGATCTTT
TTATTGGTGACATAAGGGACTCTAATAGCATCATTCCTGCAATCCAAGGA
ATCGATGCTCTCATAATTCTCACAAGTGCAGTACCAAAGATGAAACCTGA
TTTTGATCCTGCCAAAGGTGGAAGGCCTGAGTTCTACTTTGAAGAGGGTG
CATATCCTGAACAGGTTGATTGGATTGGTCAGAAAAATCAAATTGATGCT
GCTAAGGCTGCTGGAGCGAAGCAAATTGTGTTGGTTGGATCGATGGGAGG
AACAAATCTTAATCATCCCTTGAACAGTTTGGGCAATGGCAATATATTGG
TTTGGAAAAGAAAGGCTGAGCAGTATTTGGCTGACTCTGGTATTCCATAC
ACAATTATAAGGGCCGGAGGCCTTCAGATAAAGAAGGTGGTATCCGAGAA
TTACTTGTCGGTAAGGATGATGAACTTCTTCAGACAGAAACAAGGACAAT
TGCCAGGGCCGATGTTGCCGAAGTCTGCATTCAGGCACTACAGTTTGAGG
AGGCCCAATTTATGGCATTTGATCTGGCCTCAAAGCCTGAGGGAACTGG
back to top