CK740324

Overview
NameCK740324
Unique NameCK740324
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length584
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1465 contig Csv1_Contig1465:371..954. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK740324 vs. ExPASy Swiss-Prot
Match: RS4_PRUAR (40S ribosomal protein S4 OS=Prunus armeniaca GN=RPS4 PE=2 SV=1)

HSP 1 Score: 327.405 bits (838), Expect = 3.158e-89
Identity = 157/164 (95.73%), Postives = 163/164 (99.39%), Query Frame = 3
Query:    3 DVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITEFIKFDVGNVVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE 494
            DVVSIPKTNENFRLLYDTKGRFRLHSIRDEE+KFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKIT+FIKFDVGNVVMVTGGRNRGRVG+IKNREKHKGSFETIH+QDA GHEFATRLGNVFTIGKGTKPWVSLPKGKGIKL+I+EE
Sbjct:   84 DVVSIPKTNENFRLLYDTKGRFRLHSIRDEESKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITDFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLTILEE 247          
BLAST of CK740324 vs. ExPASy Swiss-Prot
Match: RS43_ARATH (40S ribosomal protein S4-3 OS=Arabidopsis thaliana GN=RPS4D PE=2 SV=2)

HSP 1 Score: 320.472 bits (820), Expect = 3.861e-87
Identity = 153/164 (93.29%), Postives = 160/164 (97.56%), Query Frame = 3
Query:    3 DVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITEFIKFDVGNVVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE 494
            DVVSIPKTNENFRLLYDTKGRFRLHSI+DEEAKFKLCKVRS+QFGQKGIPY+NTYDGRTIRYPDPLIK NDTIKLDLE NKI EFIKFDVGNVVMVTGGRNRGRVG+IKNREKHKGSFETIHIQD+ GHEFATRLGNV+TIGKGTKPWVSLPKGKGIKL+IIEE
Sbjct:   88 DVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTIGKGTKPWVSLPKGKGIKLTIIEE 251          
BLAST of CK740324 vs. ExPASy Swiss-Prot
Match: RS42_ARATH (40S ribosomal protein S4-2 OS=Arabidopsis thaliana GN=RPS4B PE=2 SV=4)

HSP 1 Score: 320.087 bits (819), Expect = 5.042e-87
Identity = 153/164 (93.29%), Postives = 160/164 (97.56%), Query Frame = 3
Query:    3 DVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITEFIKFDVGNVVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE 494
            DVVSIPKTNENFRLLYDTKGRFRLHSI+DEEAKFKLCKVRS+QFGQKGIPY+NTYDGRTIRYPDPLIK NDTIKLDLE NKI EFIKFDVGNVVMVTGGRNRGRVG+IKNREKHKGSFETIHIQD+ GHEFATRLGNV+TIGKGTKPWVSLPKGKGIKL+IIEE
Sbjct:   88 DVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTIGKGTKPWVSLPKGKGIKLTIIEE 251          
BLAST of CK740324 vs. ExPASy Swiss-Prot
Match: RS41_ARATH (40S ribosomal protein S4-1 OS=Arabidopsis thaliana GN=RPS4A PE=2 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 5.042e-87
Identity = 153/164 (93.29%), Postives = 160/164 (97.56%), Query Frame = 3
Query:    3 DVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITEFIKFDVGNVVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE 494
            DVVSIPKTNENFRLLYDTKGRFRLHSI+DEEAKFKLCKVRS+QFGQKGIPY+NTYDGRTIRYPDPLIK NDTIKLDLE NKI EFIKFDVGNVVMVTGGRNRGRVG+IKNREKHKGSFETIHIQD+ GHEFATRLGNV+TIGKGTKPWVSLPKGKGIKL+IIEE
Sbjct:   88 DVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTIGKGTKPWVSLPKGKGIKLTIIEE 251          
BLAST of CK740324 vs. ExPASy Swiss-Prot
Match: RS4_SOLTU (40S ribosomal protein S4 OS=Solanum tuberosum GN=RPS4 PE=2 SV=1)

HSP 1 Score: 319.316 bits (817), Expect = 8.601e-87
Identity = 151/164 (92.07%), Postives = 162/164 (98.78%), Query Frame = 3
Query:    3 DVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITEFIKFDVGNVVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE 494
            DVVSIPKTNENFRLLYDTKGRFRLHS+RDEE+KFKLCKVRSVQFGQKGIPY+NTYDGRTIRYPDPLIKANDTIKLDLE+NKI +FIKFDVGNVVMVTGGRNRGRVG+IKNREKHKGSFET+HIQD+ GHEFATRLGNVFT+GKGTKPWVSLPKGKGIKL+IIE+
Sbjct:   88 DVVSIPKTNENFRLLYDTKGRFRLHSLRDEESKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETLHIQDSQGHEFATRLGNVFTLGKGTKPWVSLPKGKGIKLTIIED 251          
BLAST of CK740324 vs. ExPASy Swiss-Prot
Match: RS4_MAIZE (40S ribosomal protein S4 OS=Zea mays GN=RPS4 PE=2 SV=1)

HSP 1 Score: 315.849 bits (808), Expect = 9.510e-86
Identity = 148/164 (90.24%), Postives = 160/164 (97.56%), Query Frame = 3
Query:    3 DVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITEFIKFDVGNVVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE 494
            DV+SIPKTNEN+RLLYDTKGRFRLH IRDE+AKFKLCKVRSVQFGQKGIPY+NTYDGRTIRYPDPLIKANDTIK+DLETNKI +FIKFDVGNVVMVTGGRN GRVG+IKNREKHKGSFETIH++D+LGH+FATR+GNVFTIGKG KPWVSLPKGKGIKLSIIEE
Sbjct:   88 DVISIPKTNENYRLLYDTKGRFRLHPIRDEDAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNVVMVTGGRNTGRVGVIKNREKHKGSFETIHVEDSLGHQFATRMGNVFTIGKGNKPWVSLPKGKGIKLSIIEE 251          
BLAST of CK740324 vs. ExPASy Swiss-Prot
Match: RS4_ORYSJ (40S ribosomal protein S4 OS=Oryza sativa subsp. japonica GN=RPS4 PE=2 SV=3)

HSP 1 Score: 311.997 bits (798), Expect = 1.373e-84
Identity = 146/164 (89.02%), Postives = 159/164 (96.95%), Query Frame = 3
Query:    3 DVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITEFIKFDVGNVVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE 494
            DV+SIPKT EN+RLLYDTKGRFRL S++DE+AKFKLCKVRSVQFGQKGIPY+NTYDGRTIRYPDP+IKANDTIK+DLETNKI +FIKFDVGNVVMVTGGRN GRVG+IKNREKHKGSFETIH++DALGH+FATRLGNVFTIGKG KPWVSLPKGKGIKLSIIEE
Sbjct:   88 DVISIPKTGENYRLLYDTKGRFRLQSVKDEDAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPIIKANDTIKIDLETNKIVDFIKFDVGNVVMVTGGRNTGRVGVIKNREKHKGSFETIHVEDALGHQFATRLGNVFTIGKGNKPWVSLPKGKGIKLSIIEE 251          
BLAST of CK740324 vs. ExPASy Swiss-Prot
Match: RS4_GOSHI (40S ribosomal protein S4 OS=Gossypium hirsutum GN=RPS4 PE=2 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 8.901e-84
Identity = 149/164 (90.85%), Postives = 157/164 (95.73%), Query Frame = 3
Query:    3 DVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITEFIKFDVGNVVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE 494
            DVVSIPKTNE+FRLLYDTKGRF LH+I  +E KFKLCKVRSVQFGQKGIPY+NTYDGRTIRYPDPLIKANDTIKLDLE+NKI +FIKFDVGNVVMVTGGRNRGRVG+IKNREKHKGSFETIH+QDA GHEFATRLGNVFTIGKGTKPWVSLPK KGIKLSIIEE
Sbjct:   88 DVVSIPKTNEDFRLLYDTKGRFCLHAITGDETKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDAAGHEFATRLGNVFTIGKGTKPWVSLPKRKGIKLSIIEE 251          
BLAST of CK740324 vs. ExPASy Swiss-Prot
Match: RS4_CRIGR (40S ribosomal protein S4 OS=Cricetulus griseus GN=RPS4 PE=2 SV=2)

HSP 1 Score: 247.669 bits (631), Expect = 3.180e-65
Identity = 112/164 (68.29%), Postives = 137/164 (83.54%), Query Frame = 3
Query:    3 DVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITEFIKFDVGNVVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE 494
            DV+SI KT ENFRL+YDTKGRF +H I  EEAK+KLCKVR +  G KGIP++ T+D RTIRYPDPLIK NDTI++DLET KIT+FIKFD GN+ MVTGG N GR+G+I NRE+H GSF+ +H++DA G+ FATRL N+F IGKG KPW+SLP+GKGI+L+I EE
Sbjct:   88 DVISIDKTGENFRLIYDTKGRFAVHRITSEEAKYKLCKVRKIFVGTKGIPHLVTHDARTIRYPDPLIKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLGRIGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGKGNKPWISLPRGKGIRLTIAEE 251          
BLAST of CK740324 vs. ExPASy Swiss-Prot
Match: RS4_BOVIN (40S ribosomal protein S4 OS=Bos taurus GN=RPS4 PE=2 SV=3)

HSP 1 Score: 247.284 bits (630), Expect = 4.154e-65
Identity = 112/164 (68.29%), Postives = 137/164 (83.54%), Query Frame = 3
Query:    3 DVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITEFIKFDVGNVVMVTGGRNRGRVGIIKNREKHKGSFETIHIQDALGHEFATRLGNVFTIGKGTKPWVSLPKGKGIKLSIIEE 494
            DV+SI KT ENFRL+YDTKGRF +H I  EEAK+KLCKVR +  G KGIP++ T+D RTIRYPDPLIK NDTI++DLET KIT+FIKFD GN+ MVTGG N GR+G+I NRE+H GSF+ +H++DA G+ FATRL N+F IGKG KPW+SLP+GKGI+L+I EE
Sbjct:   88 DVISIDKTGENFRLIYDTKGRFAVHRITPEEAKYKLCKVRKIFVGTKGIPHLVTHDARTIRYPDPLIKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLGRIGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGKGNKPWISLPRGKGIRLTIAEE 251          
The following BLAST results are available for this feature:
BLAST of CK740324 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 68
Match NameE-valueIdentityDescription
RS4_PRUAR3.158e-8995.7340S ribosomal protein S4 OS=Prunus armeniaca GN=RP... [more]
RS43_ARATH3.861e-8793.2940S ribosomal protein S4-3 OS=Arabidopsis thaliana... [more]
RS42_ARATH5.042e-8793.2940S ribosomal protein S4-2 OS=Arabidopsis thaliana... [more]
RS41_ARATH5.042e-8793.2940S ribosomal protein S4-1 OS=Arabidopsis thaliana... [more]
RS4_SOLTU8.601e-8792.0740S ribosomal protein S4 OS=Solanum tuberosum GN=R... [more]
RS4_MAIZE9.510e-8690.2440S ribosomal protein S4 OS=Zea mays GN=RPS4 PE=2 ... [more]
RS4_ORYSJ1.373e-8489.0240S ribosomal protein S4 OS=Oryza sativa subsp. ja... [more]
RS4_GOSHI8.901e-8490.8540S ribosomal protein S4 OS=Gossypium hirsutum GN=... [more]
RS4_CRIGR3.180e-6568.2940S ribosomal protein S4 OS=Cricetulus griseus GN=... [more]
RS4_BOVIN4.154e-6568.2940S ribosomal protein S4 OS=Bos taurus GN=RPS4 PE=... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_6468 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone RSE63H05 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK740324 ID=CK740324|Name=CK740324|organism=Citrus sinensis|type=EST|length=584bp
TGGATGTTGTGTCAATTCCAAAGACCAATGAGAACTTCCGTCTCCTTTAC
GACACCAAGGGCCGGTTCCGCCTTCATTCAATCAGGGATGAGGAGGCTAA
GTTCAAGCTCTGCAAGGTTCGATCAGTGCAATTTGGGCAGAAGGGAATCC
CTTACATCAACACTTATGATGGGAGGACTATTCGCTACCCAGACCCACTC
ATCAAGGCCAATGATACCATCAAGCTGGACCTGGAGACTAACAAGATCAC
CGAGTTCATCAAGTTTGATGTTGGAAATGTTGTGATGGTGACTGGAGGGA
GAAACAGAGGACGTGTTGGAATCATTAAGAACAGAGAAAAGCATAAGGGT
AGCTTTGAAACTATCCACATCCAGGATGCTCTTGGTCATGAGTTTGCAAC
TCGTCTTGGAAATGTGTTCACCATTGGCAAGGGTACAAAGCCATGGGTTT
CTCTTCCCAAGGGCAAGGGTATTAAACTATCCATCATTGAGGAGGCAAGG
AAGAGACAAGCCCTGGCGACTTCAGCAGCCGCCCAATGATGATAAACTTC
ATGGTCTTTGCGATATGGTTTTAGAAAGTTTACT
back to top