CK740330

Overview
NameCK740330
Unique NameCK740330
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length637
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2799 contig Csv1_Contig2799:2..639. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A2_NICPL (Eukaryotic translation initiation factor 5A-2 OS=Nicotiana plumbaginifolia GN=EIF-5A2 PE=2 SV=1)

HSP 1 Score: 306.605 bits (784), Expect = 6.922e-83
Identity = 148/159 (93.08%), Postives = 155/159 (97.48%), Query Frame = 1
Query:   85 MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALKDIGPK 561
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIKGRPCKVVEVSTSKTGKHGHAKCHFV IDIF+GKKLEDIVPSSHN DVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD+ LLTQ+KDGFAEGKDLV++VMS+MGEEQICALKDIGPK
Sbjct:    1 MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKGRPCKVVEVSTSKTGKHGHAKCHFVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDDNLLTQIKDGFAEGKDLVVSVMSAMGEEQICALKDIGPK 159          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A_MANES (Eukaryotic translation initiation factor 5A OS=Manihot esculenta PE=2 SV=2)

HSP 1 Score: 303.908 bits (777), Expect = 4.487e-82
Identity = 145/160 (90.62%), Postives = 156/160 (97.50%), Query Frame = 1
Query:   85 MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALKDIGPKS 564
            MSDEEHHFESKADAGASKT+PQQAGTIRKNGYIVIK RPCKV+EVSTSKTGKHGHAKCHFVGIDIF+GKKLEDIVPSSHN DVPHVNRTDYQLIDISEDGFVSLLTE GNTKDDLRLPTDE LL+Q+KDGFAEGKDLV++VMS+MGEE+IC+LKDIGPK+
Sbjct:    1 MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKNRPCKVMEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTETGNTKDDLRLPTDENLLSQIKDGFAEGKDLVVSVMSAMGEERICSLKDIGPKN 160          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A5_SOLTU (Eukaryotic translation initiation factor 5A-5 OS=Solanum tuberosum GN=EIF5A5 PE=2 SV=1)

HSP 1 Score: 303.908 bits (777), Expect = 4.487e-82
Identity = 146/159 (91.82%), Postives = 154/159 (96.86%), Query Frame = 1
Query:   85 MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALKDIGPK 561
            MSDEEHHFESKADAGASKTYPQQAGTIRK+G+IVIK RPCKVVEVSTSKTGKHGHAKCHFV IDIF+GKKLEDIVPSSHN DVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD+TLL Q+KDGFAEGKDLVL+VMS+MGEEQIC +KDIGPK
Sbjct:    1 MSDEEHHFESKADAGASKTYPQQAGTIRKSGHIVIKNRPCKVVEVSTSKTGKHGHAKCHFVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDDTLLAQVKDGFAEGKDLVLSVMSAMGEEQICGIKDIGPK 159          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A1_SOLLC (Eukaryotic translation initiation factor 5A-1 OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 5.860e-82
Identity = 146/159 (91.82%), Postives = 153/159 (96.23%), Query Frame = 1
Query:   85 MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALKDIGPK 561
            MSDEEHHFESKADAGASKTYPQQAGTIRK G+IVIK RPCKVVEVSTSKTGKHGHAKCHFV IDIF+GKKLEDIVPSSHN DVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD+TLL Q+KDGFAEGKDLVL+VMS+MGEEQIC +KDIGPK
Sbjct:    1 MSDEEHHFESKADAGASKTYPQQAGTIRKGGHIVIKNRPCKVVEVSTSKTGKHGHAKCHFVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDDTLLAQVKDGFAEGKDLVLSVMSAMGEEQICGIKDIGPK 159          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A4_SOLLC (Eukaryotic translation initiation factor 5A-4 OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 2.227e-81
Identity = 146/160 (91.25%), Postives = 153/160 (95.62%), Query Frame = 1
Query:   85 MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALKDIGPKS 564
            MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFV IDIF+ KKLEDIVPSSHN DVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD+TLL Q+K GF EGKDLVL+VMS+MGEEQICA+KDIG K+
Sbjct:    1 MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVAIDIFNAKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDDTLLNQVKGGFEEGKDLVLSVMSAMGEEQICAVKDIGTKT 160          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A1_TOBAC (Eukaryotic translation initiation factor 5A-1 OS=Nicotiana tabacum GN=EIF-5A1 PE=3 SV=1)

HSP 1 Score: 301.212 bits (770), Expect = 2.908e-81
Identity = 144/159 (90.57%), Postives = 152/159 (95.60%), Query Frame = 1
Query:   85 MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALKDIGPK 561
            MSDEEHHFESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHFV IDIF+GKKLEDIVPSSHN DVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD+ LL  +KDGFAEGKDLVL+VMS+MGEEQIC +KD+GPK
Sbjct:    1 MSDEEHHFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHFVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDDNLLALIKDGFAEGKDLVLSVMSAMGEEQICGIKDVGPK 159          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A1_SOLTU (Eukaryotic translation initiation factor 5A-1/2 OS=Solanum tuberosum GN=EIF5A1 PE=2 SV=1)

HSP 1 Score: 301.212 bits (770), Expect = 2.908e-81
Identity = 146/160 (91.25%), Postives = 153/160 (95.62%), Query Frame = 1
Query:   85 MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALKDIGPKS 564
            MSDEEHHFESKADAGASKTYPQQAGTIRK+GYIVIKGRPCKVVEVSTSKTGKHGHAKCHFV IDIF+GKKLEDIVPSSHN DVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD+ LL Q+K GF EGKDLVL+VMS+MGEEQICA+KDIG KS
Sbjct:    1 MSDEEHHFESKADAGASKTYPQQAGTIRKSGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDDALLNQVKGGFEEGKDLVLSVMSAMGEEQICAVKDIGTKS 160          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A1_NICPL (Eukaryotic translation initiation factor 5A-1 OS=Nicotiana plumbaginifolia GN=EIF-5A1 PE=2 SV=1)

HSP 1 Score: 301.212 bits (770), Expect = 2.908e-81
Identity = 144/159 (90.57%), Postives = 152/159 (95.60%), Query Frame = 1
Query:   85 MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALKDIGPK 561
            MSDEEHHFESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHFV IDIF+GKKLEDIVPSSHN DVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD+ LL  +KDGFAEGKDLVL+VMS+MGEEQIC +KD+GPK
Sbjct:    1 MSDEEHHFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHFVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDDNLLALIKDGFAEGKDLVLSVMSAMGEEQICGIKDVGPK 159          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A2_MEDSA (Eukaryotic translation initiation factor 5A-2 OS=Medicago sativa PE=2 SV=1)

HSP 1 Score: 300.056 bits (767), Expect = 6.479e-81
Identity = 143/159 (89.94%), Postives = 154/159 (96.86%), Query Frame = 1
Query:   85 MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALKDIGPK 561
            MSDEEHHFE  ADAGASKTYPQQAGTIRKNGYIVIK RPCKVVEVSTSKTGKHGHAKCHFV IDIF+GKKLEDIVPSSHN DVPHVNRTDYQLIDISEDGFVSLLT+NG+TKDDL+LPTD++LLTQ+KDGFA+GKDLV++VMS+MGEEQICALKDIGPK
Sbjct:    1 MSDEEHHFEPAADAGASKTYPQQAGTIRKNGYIVIKSRPCKVVEVSTSKTGKHGHAKCHFVAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDNGSTKDDLKLPTDDSLLTQIKDGFADGKDLVVSVMSAMGEEQICALKDIGPK 159          
BLAST of CK740330 vs. ExPASy Swiss-Prot
Match: IF5A4_SOLTU (Eukaryotic translation initiation factor 5A-4 OS=Solanum tuberosum GN=EIF5A4 PE=2 SV=1)

HSP 1 Score: 299.671 bits (766), Expect = 8.462e-81
Identity = 145/159 (91.19%), Postives = 155/159 (97.48%), Query Frame = 1
Query:   85 MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALKDIGPK 561
            MSDEEH FESKADAGASKTYPQQAGTIRK+GYIVIKGRPCKVVEVSTSKTGKHGHAKCHFV IDIF+GKKLEDIVPSSHN DVPHVNRTDYQLIDISEDGFVSLLT+NGNTKDDLRLPTD++LL+Q+KDGFAEGKDLV++VMS+MGEEQI ALKDIGPK
Sbjct:    1 MSDEEHQFESKADAGASKTYPQQAGTIRKSGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDNGNTKDDLRLPTDDSLLSQIKDGFAEGKDLVVSVMSAMGEEQINALKDIGPK 159          
The following BLAST results are available for this feature:
BLAST of CK740330 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 60
Match NameE-valueIdentityDescription
IF5A2_NICPL6.922e-8393.08Eukaryotic translation initiation factor 5A-2 OS=N... [more]
IF5A_MANES4.487e-8290.63Eukaryotic translation initiation factor 5A OS=Man... [more]
IF5A5_SOLTU4.487e-8291.82Eukaryotic translation initiation factor 5A-5 OS=S... [more]
IF5A1_SOLLC5.860e-8291.82Eukaryotic translation initiation factor 5A-1 OS=S... [more]
IF5A4_SOLLC2.227e-8191.25Eukaryotic translation initiation factor 5A-4 OS=S... [more]
IF5A1_TOBAC2.908e-8190.57Eukaryotic translation initiation factor 5A-1 OS=N... [more]
IF5A1_SOLTU2.908e-8191.25Eukaryotic translation initiation factor 5A-1/2 OS... [more]
IF5A1_NICPL2.908e-8190.57Eukaryotic translation initiation factor 5A-1 OS=N... [more]
IF5A2_MEDSA6.479e-8189.94Eukaryotic translation initiation factor 5A-2 OS=M... [more]
IF5A4_SOLTU8.462e-8191.19Eukaryotic translation initiation factor 5A-4 OS=S... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_6474 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone RSE63H11 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK740330 ID=CK740330|Name=CK740330|organism=Citrus sinensis|type=EST|length=637bp
CTCCCTCGCTCGGTCGCCCCCCAGCCTCTCTCAAAATCTCGCTCAGTAAA
TCGGCCGAGTCGGAATCAGTCAGTGCTTAAAACGATGTCGGACGAGGAGC
ATCACTTCGAGTCAAAGGCCGATGCCGGAGCCTCCAAGACTTACCCGCAG
CAAGCTGGTACCATCCGTAAGAATGGCTACATCGTCATCAAAGGCCGTCC
CTGCAAGGTTGTGGAAGTCTCCACCTCCAAGACTGGAAAGCACGGTCATG
CTAAGTGCCACTTTGTTGGAATTGATATCTTCAGTGGAAAGAAGTTGGAA
GATATTGTCCCCTCTTCTCATAACTCTGATGTTCCCCATGTCAACCGTAC
CGACTATCAGTTGATTGATATTTCTGAGGATGGATTTGTGAGTTTGCTGA
CTGAAAATGGGAACACCAAGGATGATCTGAGGCTCCCAACCGATGAGACT
CTGCTGACCCAGCTCAAGGACGGTTTTGCTGAGGGGAAGGACTTGGTTTT
GACTGTCATGTCTTCAATGGGTGAGGAGCAGATCTGTGCCCTCAAGGATA
TTGGCCCAAAGTCGTAGTTGCGCAATATGTGATTATCTGCTATGTCTGGT
TGCATCTGTTTTTTGGAAAATATTTTAATCATCTAGA
back to top