CK932590

Overview
NameCK932590
Unique NameCK932590
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length649
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CK932590_ssr478 microsatellite CK932590_ssr478:478..492. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig1452 contig Csv1_Contig1452:1..649. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK932590 vs. ExPASy Swiss-Prot
Match: NLTP_VIGUN (Probable non-specific lipid-transfer protein AKCS9 OS=Vigna unguiculata PE=2 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 5.374e-22
Identity = 48/95 (50.53%), Postives = 67/95 (70.53%), Query Frame = 3
Query:   75 KMEASHVAAICTLVVLLLAAETQVSVAVTCSPTQLSSCVSAITSSTPPSRLRCSKIKEQKPCLCQYLRNPSLRKFINTPNARRVASTCGTPFPKC 359
            KM+ S V A+  +V L L     V+ AVTC+PT+LSSCV AIT  + PS   CSK+K Q+PCLC Y++NPSL++++N+P A++V S CG  +P C
Sbjct:    6 KMKMSVVCAV-VVVALFLIDVGPVAEAVTCNPTELSSCVPAITGGSKPSSTCCSKLKVQEPCLCNYIKNPSLKQYVNSPGAKKVLSNCGVTYPNC 99          
BLAST of CK932590 vs. ExPASy Swiss-Prot
Match: NLTP2_PRUAR (Non-specific lipid-transfer protein 2 OS=Prunus armeniaca PE=1 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.121e-19
Identity = 39/68 (57.35%), Postives = 51/68 (75.00%), Query Frame = 3
Query:  156 VTCSPTQLSSCVSAITSSTPPSRLRCSKIKEQKPCLCQYLRNPSLRKFINTPNARRVASTCGTPFPKC 359
            VTCSP QLS C+  I S  P     C K++EQ+PCLC YL+NPSLR+++N+PNAR++AS CG P P+C
Sbjct:    1 VTCSPVQLSPCLGPINSGAPSPTTCCQKLREQRPCLCGYLKNPSLRQYVNSPNARKLASNCGVPVPQC 68          
BLAST of CK932590 vs. ExPASy Swiss-Prot
Match: NLTP2_HORVU (Probable non-specific lipid-transfer protein OS=Hordeum vulgare GN=LTP2 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 7.035e-14
Identity = 33/94 (35.11%), Postives = 51/94 (54.26%), Query Frame = 3
Query:   78 MEASHVAAICTLVVLLLAAETQVSVAVTCSPTQLSSCVSAITSSTPPSRLRCSKIKEQKPCLCQYLRNPSLRKFINTPNARRVASTCGTPFPKC 359
            M      A+  ++V+ LAA         C P QL+ C SAI   T PS   C  ++ Q+ CLCQY+++P+   ++++P+AR   + CG P P C
Sbjct:    9 MRKEAAVAVMMVMVVTLAAGADAGAGAACEPAQLAVCASAILGGTKPSGECCGNLRAQQGCLCQYVKDPNYGHYVSSPHARDTLNLCGIPVPHC 102          
BLAST of CK932590 vs. ExPASy Swiss-Prot
Match: NLTPX_ORYSI (Non-specific lipid-transfer protein 2 OS=Oryza sativa subsp. indica GN=LTP-2 PE=2 SV=2)

HSP 1 Score: 67.0106 bits (162), Expect = 9.508e-11
Identity = 31/90 (34.44%), Postives = 50/90 (55.56%), Query Frame = 3
Query:   99 AICTLVVLLLAAETQVSVAV---TCSPTQLSSCVSAITSSTPPSRLRCSKIKEQKPCLCQYLRNPSLRKFINTPNARRVASTCGTPFPKC 359
            A+  L V ++AA     V V   +C+  QL+ C  AI     P+   CS ++ Q+ C CQ+ ++P   +++N+PNAR+  S+CG   P C
Sbjct:    6 AVLVLAVAMVAACGGGVVGVAGASCNAGQLTVCAGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTC 95          
The following BLAST results are available for this feature:
BLAST of CK932590 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
NLTP_VIGUN5.374e-2250.53Probable non-specific lipid-transfer protein AKCS9... [more]
NLTP2_PRUAR1.121e-1957.35Non-specific lipid-transfer protein 2 OS=Prunus ar... [more]
NLTP2_HORVU7.035e-1435.11Probable non-specific lipid-transfer protein OS=Ho... [more]
NLTPX_ORYSI9.508e-1134.44Non-specific lipid-transfer protein 2 OS=Oryza sat... [more]
back to top
Libraries
Library NameType
Developing fruit juice sac at 38 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004531_H02 Developing fruit juice sac at 38 DAFB Citrus sinensis cDNA clone JSJune0002_IIIF_H02 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK932590 ID=CK932590|Name=CK932590|organism=Citrus sinensis|type=EST|length=649bp
GGGGACAGCATCACCCATCTAACAAAGCACATTAGTCTCGAGCTTGTAAG
TCCATTTGATTCATACTACATCGAAAAATGGAGGCTTCGCATGTAGCAGC
CATTTGCACATTGGTGGTTCTTCTTCTGGCAGCTGAAACACAAGTCTCAG
TGGCAGTGACATGCAGCCCAACCCAACTGAGCTCTTGTGTTAGCGCCATC
ACATCTTCAACTCCACCATCAAGGCTCCGCTGTAGCAAGATCAAAGAACA
GAAGCCTTGCCTTTGCCAGTACCTTCGAAACCCGAGCCTCAGGAAGTTTA
TCAACACCCCAAATGCCAGGAGAGTTGCTAGCACTTGTGGCACTCCCTTC
CCAAAATGCTAAATTTCTCTTCTCTCCCATTTCACTTTGCTGCATTAATC
TCGTTTAATGCATAGTCTAATATCGAGTGGTGATTGAAGAGAATTATGAG
TTAGTAGTTTAATTGTGCTGTGTTTTATGTTGTTGTTGTTGTGATACTTG
TGGAAACAATGTTGGGGGTCATGGGTTACATCACATGGCACCAACATCTG
TCTTAGCTAGTGTGTTCTGTTTGTTCCGAAGGCACTATTTATTATTTATA
AGGGAAATCACTGTTGTATCGAAAAAAAAAAAAAAAAAAAAAAAAAAAA
back to top