CK933034

Overview
NameCK933034
Unique NameCK933034
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length598
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10569 contig Csv1_Contig10569:282..878. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK933034 vs. ExPASy Swiss-Prot
Match: AFC2_ARATH (Serine/threonine-protein kinase AFC2 OS=Arabidopsis thaliana GN=AFC2 PE=1 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 6.890e-18
Identity = 40/52 (76.92%), Postives = 50/52 (96.15%), Query Frame = 2
Query:    5 VMKLPRLQNLIMQHVDHSAGDLTHLLQGLLRYDPTDRLTAREALRHPFFYKR 160
            V+KLPRLQNLIMQHVDHSAG+L +++QGLLR+DP++R+TAREALRHPFF +R
Sbjct:  375 VLKLPRLQNLIMQHVDHSAGELINMVQGLLRFDPSERITAREALRHPFFARR 426          
BLAST of CK933034 vs. ExPASy Swiss-Prot
Match: AFC1_ARATH (Serine/threonine-protein kinase AFC1 OS=Arabidopsis thaliana GN=AFC1 PE=2 SV=2)

HSP 1 Score: 85.8853 bits (211), Expect = 1.697e-16
Identity = 41/49 (83.67%), Postives = 42/49 (85.71%), Query Frame = 2
Query:    5 VMKLPRLQNLIMQHVDHSAGDLTHLLQGLLRYDPTDRLTAREALRHPFF 151
            V KLPRL NLIMQHVDHSAGDL  LLQGLLRYDPT+R  AREAL HPFF
Sbjct:  395 VWKLPRLPNLIMQHVDHSAGDLIDLLQGLLRYDPTERFKAREALNHPFF 443          
The following BLAST results are available for this feature:
BLAST of CK933034 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
AFC2_ARATH6.890e-1876.92Serine/threonine-protein kinase AFC2 OS=Arabidopsi... [more]
AFC1_ARATH1.697e-1683.67Serine/threonine-protein kinase AFC1 OS=Arabidopsi... [more]
back to top
Libraries
Library NameType
Developing fruit juice sac at 38 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004348_E02 Developing fruit juice sac at 38 DAFB Citrus sinensis cDNA clone JSJune0004_IIF_E02 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK933034 ID=CK933034|Name=CK933034|organism=Citrus sinensis|type=EST|length=598bp
GGGTGTGATGAAGCTACCTCGTCTTCAGAACCTAATAATGCAGCACGTTG
ACCATTCAGCTGGTGATCTTACACACTTATTGCAAGGACTGCTTAGGTAT
GATCCTACGGACAGGCTAACTGCGCGTGAAGCTCTTAGGCATCCCTTTTT
TTACAAGAGATCATCTTAGGAGATAGGTACCCATATACTTGTTACACAAT
TCTCCGGTTGCAATATGCGGTGGTTAGAAGCCAAGTATCACAGTTGTGGG
ATCTGGGTTGTTCTATTTTGTTGTGCTGTTGCATGTTCTTACTTATCTAA
CCCAAATCTGAGGCACTGTGAATATTTGACATTAAGAAATGGAATTTGTG
GGGGAAAAAGGGTGGAGGATTTTCCTCTTCACCCAACAAAAGACCTAGGT
ATGTGTTGTACATGGTGGAGTTAGTTTCTTGGCATGATTTTGCCTACAAA
TGTGACTAACCAAAGTGTAAAATATTGGATCTTTTGTATCTGCAGAAATT
ATTTTCATATGCAGAAATGATTTCTTCTAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
back to top