CK934446

Overview
NameCK934446
Unique NameCK934446
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length788
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CK934446 vs. ExPASy Swiss-Prot
Match: ML423_ARATH (MLP-like protein 423 OS=Arabidopsis thaliana GN=MLP423 PE=1 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 5.390e-44
Identity = 83/145 (57.24%), Postives = 109/145 (75.17%), Query Frame = 1
Query:   46 GKLEVELEVKSSADKFWGSIRDSTTLFPKAFSHDYKSIQVLEGDGKAPGSVRLITYADGSPIVKVSTEKIENVDEANKVVTYKVIDGDLLKYYKAFKGIVSVNPKGEGSLVKWACEFEKAXXXXXXXXXXKDFALKNFQEVDDYI 480
            G L VE+EVKS A+KFW ++ D   LFPKAF +DYK+IQVL GDG APGS+RLITY +GSP+VK+S E+IE VD  NK ++Y +I G++L+YYK FKG ++V PK  GSL+KW+ EFEK           KDFA+KNF+E+D+Y+
Sbjct:    5 GVLHVEVEVKSPAEKFWVALGDGINLFPKAFPNDYKTIQVLAGDGNAPGSIRLITYGEGSPLVKISAERIEAVDLENKSMSYSIIGGEMLEYYKTFKGTITVIPKDGGSLLKWSGEFEKTAHEIDDPHVIKDFAVKNFKEIDEYL 149          
BLAST of CK934446 vs. ExPASy Swiss-Prot
Match: MLP28_ARATH (MLP-like protein 28 OS=Arabidopsis thaliana GN=MLP28 PE=1 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.634e-16
Identity = 53/156 (33.97%), Postives = 83/156 (53.21%), Query Frame = 1
Query:   22 KSRMASAGGKLEVELEVKSSADKFWGSIRDSTTLFPKAFSHDYKSIQVLEGDGKAPGSVRLITYA-DGSPIVKVSTEKIENVDEANKVVTYKVIDGDLLKYYKAFKGIVSVNPK--GEGSLVKWACEFEKAXXXXXXXXXXKDFALKNFQEVDDYI 480
            K+  +S  GKLE ++E+K+SADKF            KA   + +   + EGD    GS+    Y  DG    KV+ E+IE V+    ++T++VI+GDL+K YK+F   + V PK  G GS+V W  E+EK             F ++  +E+D+++
Sbjct:   16 KTEASSLVGKLETDVEIKASADKFHHMFAGKPHHVSKASPGNIQGCDLHEGDWGTVGSIVFWNYVHDGE--AKVAKERIEAVEPDKNLITFRVIEGDLMKEYKSFLLTIQVTPKPGGPGSIVHWHLEYEKISEEVAHPETLLQFCVEVSKEIDEHL 169          

HSP 2 Score: 82.8037 bits (203), Expect = 2.360e-15
Identity = 49/147 (33.33%), Postives = 77/147 (52.38%), Query Frame = 1
Query:   46 GKLEVELEVKSSADKFWGSIRDSTTLFPKAFSHDYKSIQVLEGDGKAPGSVRLITYADGSPIVKVSTEKIENVDEANKVVTYKVIDGDLLKYYKAFKGIVSVNPK--GEGSLVKWACEFEKAXXXXXXXXXXKDFALKNFQEVDDYI 480
            GKLE ++E+K+SA+KF            KA   + +   + EGD    GS+    Y       KV+ E+IE V+    ++T++VIDGDL+K YK+F   + V PK  G GS+V W  E+EK             F ++  +E+D+++
Sbjct:  186 GKLETDVEIKASAEKFHHMFAGKPHHVSKASPGNIQGCDLHEGDWGQVGSIVFWNYVHDRE-AKVAKERIEAVEPNKNLITFRVIDGDLMKEYKSFLLTIQVTPKLGGPGSIVHWHLEYEKISEEVAHPETLLQFCVEVSKEIDEHL 331          
BLAST of CK934446 vs. ExPASy Swiss-Prot
Match: MLP34_ARATH (MLP-like protein 34 OS=Arabidopsis thaliana GN=MLP34 PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.134e-16
Identity = 54/156 (34.62%), Postives = 82/156 (52.56%), Query Frame = 1
Query:   22 KSRMASAGGKLEVELEVKSSADKFWGSIRDSTTLFPKAFSHDYKSIQVLEGDGKAPGSVRLITYA-DGSPIVKVSTEKIENVDEANKVVTYKVIDGDLLKYYKAFKGIVSVNPK--GEGSLVKWACEFEKAXXXXXXXXXXKDFALKNFQEVDDYI 480
            K+   S  GKLE E+E+K+SA +F            KA   + +S  + EGD    GS+    Y  DG    KV+ E+IE V+    ++T++VI+GDL+K YK+F   + V PK  G GS+V W  E+EK             F ++  QE+D+++
Sbjct:    3 KTEAPSLVGKLETEVEIKASAGQFHHMFAGKPHHVSKASPGNIQSCDLHEGDWGTVGSIVFWNYVHDGE--AKVAKERIEAVEPEKNLITFRVIEGDLMKEYKSFLITIQVTPKHGGPGSIVHWHLEYEKISDEVAHPETLLQFCVEVSQEIDEHL 156          

HSP 2 Score: 84.3445 bits (207), Expect = 8.111e-16
Identity = 52/146 (35.62%), Postives = 79/146 (54.11%), Query Frame = 1
Query:   52 LEVELEVKSSADKFWGSIRDSTTLFPKAFSHDYKSIQVLEGDGKAPGSVRLITYA-DGSPIVKVSTEKIENVDEANKVVTYKVIDGDLLKYYKAFKGIVSVNPK--GEGSLVKWACEFEKAXXXXXXXXXXKDFALKNFQEVDDYI 480
            LE E+E+K+SA+KF            KA   + +S  + EGD    GS+    Y  DG    KV+ E+IE VD    ++T++VI+GDL+K YK+F   + V PK  G GS+V W  E+EK             FA++  +E+D+++
Sbjct:  169 LETEVEIKASAEKFHHMFAGKPHHVSKATPGNIQSCDLHEGDWGTVGSIVFWNYVHDGE--AKVAKERIEAVDPEKNLITFRVIEGDLMKEYKSFVITIQVTPKHGGSGSVVHWHFEYEKINEEVAHPETLLQFAVEVSKEIDEHL 312          
BLAST of CK934446 vs. ExPASy Swiss-Prot
Match: MLP31_ARATH (MLP-like protein 31 OS=Arabidopsis thaliana GN=MLP31 PE=1 SV=2)

HSP 1 Score: 85.8853 bits (211), Expect = 2.788e-16
Identity = 54/156 (34.62%), Postives = 82/156 (52.56%), Query Frame = 1
Query:   22 KSRMASAGGKLEVELEVKSSADKFWGSIRDSTTLFPKAFSHDYKSIQVLEGDGKAPGSVRLITYA-DGSPIVKVSTEKIENVDEANKVVTYKVIDGDLLKYYKAFKGIVSVNPK--GEGSLVKWACEFEKAXXXXXXXXXXKDFALKNFQEVDDYI 480
            K   +S  GKLE ++E+K+SA KF            KA     +  ++ EGD    GS+    Y  DG    KV+ E+IE V+    ++T++VI+GDLLK YK+F   + V PK  G GS+V W  E+EK            DF ++  +E+D+++
Sbjct:   14 KRESSSLCGKLETDIEIKASAGKFHHMFAGRPHHVSKATPGKIQGCELHEGDWGKVGSIVFWNYVHDGE--AKVAKERIEAVEPEKNLITFRVIEGDLLKEYKSFVITIQVTPKRGGPGSVVHWHVEYEKIDDKVAHPETFLDFCVEVSKEIDEHL 167          
BLAST of CK934446 vs. ExPASy Swiss-Prot
Match: MLP43_ARATH (MLP-like protein 43 OS=Arabidopsis thaliana GN=MLP43 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 9.915e-14
Identity = 49/151 (32.45%), Postives = 76/151 (50.33%), Query Frame = 1
Query:   34 ASAGGKLEVELEVKSSADKFWGSIRDSTTLFPKAFSHDYKSIQVLEGDGKAPGSVRLITYADGSPIVKVSTEKIENVDEANKVVTYKVIDGDLLKYYKAFKGIVSVNPK-GE-GSLVKWACEFEKAXXXXXXXXXXKDFALKNFQEVDDYI 480
            +S  GKLE E+E+K+SA KF     +      KA        ++ EGD    GS+ +  Y     +  V   KIE VD    ++T+KV++GDL+  YK+F   + V PK GE GS+  W  E+EK             F ++  +E+D+++
Sbjct:    5 SSLVGKLETEVEIKASAKKFHHMFTERPHHVSKATPDKIHGCELHEGDWGKVGSIVIWKYVHDGKLT-VGKNKIEAVDPEKNLITFKVLEGDLMNEYKSFAFTLQVTPKQGESGSIAHWHLEYEKISEEVAHPETLLQFCVEISKEIDEHL 154          
BLAST of CK934446 vs. ExPASy Swiss-Prot
Match: ML165_ARATH (MLP-like protein 165 OS=Arabidopsis thaliana GN=MLP165 PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 4.921e-13
Identity = 52/148 (35.14%), Postives = 84/148 (56.76%), Query Frame = 1
Query:   49 KLEVELEVKSSADKFWGSIRDSTTLFPKAFSHDYKSIQVLEGDGKAPGSVRLITYA-DGSPIVKVSTEKIENVDEANKVVTYKVIDGDLLKYYKAF-KGIVSVNPK--GEGSLVKWACEFEKAXXXXXXXXXXKDFALKNFQEVDDYI 480
            ++EV++++K+ ADKF   IR S  + PKA +H  K   +LEG+    GS+ L     DG P  +VS + IE +DE   V+  +V++G L K YK+F K +  ++PK  G GS+VKW  ++E+             F ++  +E+D Y+
Sbjct:    5 EIEVDVDIKTRADKFHKFIRRSQHV-PKA-THYIKGCDLLEGEWGKVGSILLWKLVFDGEP--RVSKDMIEVIDEEKNVIQLRVLEGPLKKEYKSFLKTMKVMSPKHGGPGSVVKWNMKYERIDQNVDHPNRLLQFFVEVTKEIDQYL 148          
BLAST of CK934446 vs. ExPASy Swiss-Prot
Match: ML146_PAPSO (Major latex protein 146 OS=Papaver somniferum GN=MLP146 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 3.526e-11
Identity = 41/122 (33.61%), Postives = 65/122 (53.28%), Query Frame = 1
Query:   46 GKLEVELEVKSSADKFWGSIRDSTTLFPKAFSHDYKSIQVLEGDGKAPGSVRLITYA-DGSPIVKVSTEKIENVDEANKVVTYKVIDGDLLKYYKAFKGIVSVNPK--GEGSLVKWACEFEK 402
            GKL +E EV  +ADK++   +    L P    H Y S++ +EG G   G V+   Y  +G P+   S ++    ++  + + + V+ GDL+  YK F   + VNPK  G G +VKW  ++EK
Sbjct:   12 GKLVMESEVNCNADKYYKLYKHHEDL-PSVIPHIYTSVKAVEGHGTTSGCVKEWGYILEGKPL---SCKEKTTYNDETRTIHHMVVAGDLMNDYKKFDATLVVNPKSNGHGCIVKWTIDYEK 129          
BLAST of CK934446 vs. ExPASy Swiss-Prot
Match: ML168_ARATH (MLP-like protein 168 OS=Arabidopsis thaliana GN=MLP168 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 6.015e-11
Identity = 46/153 (30.07%), Postives = 79/153 (51.63%), Query Frame = 1
Query:   49 KLEVELEVKSSADKFWGSIRDSTTLFPKAFSHDYKSIQ------VLEGDGKAPGSVRLITYA-DGSPIVKVSTEKIENVDEANKVVTYKVIDGDLLKYYKAFKGIVSVNPK--GEGSLVKWACEFEKAXXXXXXXXXXKDFALKNFQEVDDYI 480
            ++EV++E+KS+ADKF+        +F +   H  K+ +      +LEG+    GS+ L     DG P  KVS + IE +D    ++ ++V++G L + Y  F   + V+PK  G GS+VKW  ++E+             F ++   E+D Y+
Sbjct:    5 EVEVDVEIKSTADKFF--------MFSRRSQHASKATRYVQGCDLLEGEWGEVGSILLWKLTVDGEP--KVSKDMIEAIDMKMNMIQWRVLEGPLKEEYNIFSKTMKVSPKQGGSGSVVKWNLKYERIDEKVAHLERLLQFFVECVNEIDQYL 147          
The following BLAST results are available for this feature:
BLAST of CK934446 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
ML423_ARATH5.390e-4457.24MLP-like protein 423 OS=Arabidopsis thaliana GN=ML... [more]
MLP28_ARATH1.634e-1633.97MLP-like protein 28 OS=Arabidopsis thaliana GN=MLP... [more]
MLP34_ARATH2.134e-1634.62MLP-like protein 34 OS=Arabidopsis thaliana GN=MLP... [more]
MLP31_ARATH2.788e-1634.62MLP-like protein 31 OS=Arabidopsis thaliana GN=MLP... [more]
MLP43_ARATH9.915e-1432.45MLP-like protein 43 OS=Arabidopsis thaliana GN=MLP... [more]
ML165_ARATH4.921e-1335.14MLP-like protein 165 OS=Arabidopsis thaliana GN=ML... [more]
ML146_PAPSO3.526e-1133.61Major latex protein 146 OS=Papaver somniferum GN=M... [more]
ML168_ARATH6.015e-1130.07MLP-like protein 168 OS=Arabidopsis thaliana GN=ML... [more]
back to top
Properties
Property NameValue
Genbank descriptionCGF1004259_A10 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10004_IIF_A10 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK934446 ID=CK934446|Name=CK934446|organism=Citrus sinensis|type=EST|length=788bp
GGGGATCCATCTCAACACAACAAATCGAGAATGGCTTCTGCAGGTGGGAA
GCTTGAAGTCGAGCTTGAGGTGAAGTCATCGGCTGACAAATTCTGGGGAA
GCATTAGGGACTCCACCACTCTGTTTCCCAAGGCATTCTCTCACGATTAC
AAGAGCATCCAAGTGCTGGAGGGCGACGGCAAGGCCCCTGGCTCTGTGCG
TCTCATCACTTATGCTGACGGTTCTCCAATTGTGAAGGTATCGACAGAGA
AGATCGAGAATGTAGATGAAGCAAACAAGGTGGTTACTTACAAGGTAATT
GATGGGGACCTGTTGAAGTACTACAAGGCTTTCAAAGGCATCGTGAGTGT
TAATCCGAAGGGGGAAGGGAGCTTGGTGAAGTGGGCTTGTGAGTTTGAAA
AGGCAAGCGATGATGTTCCCGATCCAAGCGTCGTCAAGGACTTTGCACTC
AAGAACTTTCAGGAAGTGGATGACTATATTCTCAAGGCCAATTAATTAGG
AGCAAAAGCTGCCTAAGCACGCACTTACGTTGCATATATATCATGTATTA
ATCTTGTGCTTGTGTTGTTGGACTTTTAAAATAACAATATTATTAAGAAT
GTGGAGTCATTACCTTCCGCTATGTATTCTATACATTGTTTATTCTGTTA
TGTCTCTGTATTGTGAGTTGGTAAGGAGTAAGAGCTTCTCCGCCAGCTAC
TATTTAATTACCTCCATTAGTATTTATATATTGCTTCATTAAATAAAAGC
CGAGCTTCAGAAAAAAAAAAAAAAAAAAAAAAAAAAAA
back to top