CK935407

Overview
NameCK935407
Unique NameCK935407
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length474
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CK935407 vs. ExPASy Swiss-Prot
Match: CML27_ARATH (Probable calcium-binding protein CML27 OS=Arabidopsis thaliana GN=CML27 PE=1 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 4.191e-23
Identity = 50/65 (76.92%), Postives = 57/65 (87.69%), Query Frame = 1
Query:    1 ELREAFDLYDQDKNGLISAEELNLVLNRLGIKCSVDGCVAMIKPVDADGDGNVNFEEFRSMMTTS 195
            E+R+AFDLYDQDKNGLISA EL+ VLNRLG+ CSV+ C  MI PVDADGDGNVNFEEF+ MMT+S
Sbjct:   92 EIRDAFDLYDQDKNGLISASELHQVLNRLGMSCSVEDCTRMIGPVDADGDGNVNFEEFQKMMTSS 156          
BLAST of CK935407 vs. ExPASy Swiss-Prot
Match: CML26_ARATH (Probable calcium-binding protein CML26 OS=Arabidopsis thaliana GN=CML26 PE=1 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 3.321e-20
Identity = 45/64 (70.31%), Postives = 55/64 (85.94%), Query Frame = 1
Query:    1 ELREAFDLYDQDKNGLISAEELNLVLNRLGIKCSVDGCVAMIKPVDADGDGNVNFEEFRSMMTT 192
            E+REAFDLYDQ+KNGLIS+ E++ VLNRLG+ CSV+ CV MI  VD DGDGNVNFEEF+ MM++
Sbjct:   89 EIREAFDLYDQNKNGLISSSEIHKVLNRLGMTCSVEDCVRMIGHVDTDGDGNVNFEEFQKMMSS 152          
BLAST of CK935407 vs. ExPASy Swiss-Prot
Match: CML18_ORYSJ (Probable calcium-binding protein CML18 OS=Oryza sativa subsp. japonica GN=CML18 PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 6.481e-16
Identity = 41/62 (66.13%), Postives = 47/62 (75.81%), Query Frame = 1
Query:    1 ELREAFDLYDQDKNGLISAEELNLVLNRLGIKCSVDGCVAMIKPVDADGDGNVNFEEFRSMM 186
            ELREAF +YD D NG ISA EL+ VL +LG KCSV  C  MI+ VDADGDG VNF+EF+ MM
Sbjct:   90 ELREAFRMYDADSNGKISARELHRVLRQLGDKCSVADCSRMIRSVDADGDGCVNFDEFKKMM 151          
BLAST of CK935407 vs. ExPASy Swiss-Prot
Match: ALL8_OLEEU (Calcium-binding allergen Ole e 8 OS=Olea europaea PE=1 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 6.481e-16
Identity = 40/63 (63.49%), Postives = 50/63 (79.37%), Query Frame = 1
Query:    1 ELREAFDLYDQDKNGLISAEELNLVLNRLGIKCSVDGCVAMIKPVDADGDGNVNFEEFRSMMT 189
            EL+EAF+LYDQD NGLIS+ EL+ +L RLG + +   CV MIK VD+DGDG V+FEEF+ MMT
Sbjct:   96 ELKEAFELYDQDHNGLISSVELHKILTRLGERYAEHDCVEMIKSVDSDGDGYVSFEEFKKMMT 158          
BLAST of CK935407 vs. ExPASy Swiss-Prot
Match: CML23_ARATH (Probable calcium-binding protein CML23 OS=Arabidopsis thaliana GN=CML23 PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.886e-15
Identity = 38/62 (61.29%), Postives = 47/62 (75.81%), Query Frame = 1
Query:    1 ELREAFDLYDQDKNGLISAEELNLVLNRLGIKCSVDGCVAMIKPVDADGDGNVNFEEFRSMM 186
            +L+EAFDLYD D+NG ISA EL+ V+  LG KCS+  C  MI  VD+DGDG V+FEEF+ MM
Sbjct:   90 DLKEAFDLYDLDRNGRISANELHSVMKNLGEKCSIQDCQRMINKVDSDGDGCVDFEEFKKMM 151          
BLAST of CK935407 vs. ExPASy Swiss-Prot
Match: CML24_ARATH (Calcium-binding protein CML24 OS=Arabidopsis thaliana GN=CML24 PE=2 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 7.165e-15
Identity = 38/63 (60.32%), Postives = 47/63 (74.60%), Query Frame = 1
Query:    1 ELREAFDLYDQDKNGLISAEELNLVLNRLGIKCSVDGCVAMIKPVDADGDGNVNFEEFRSMMT 189
            +L+EAF+LYD D NG ISA+EL+ V+  LG KCSV  C  MI  VD DGDG VNF+EF+ MM+
Sbjct:   94 DLKEAFELYDLDGNGRISAKELHSVMKNLGEKCSVQDCKKMISKVDIDGDGCVNFDEFKKMMS 156          
BLAST of CK935407 vs. ExPASy Swiss-Prot
Match: CML32_ARATH (Probable calcium-binding protein CML32 OS=Arabidopsis thaliana GN=CML32 PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 9.358e-15
Identity = 37/66 (56.06%), Postives = 53/66 (80.30%), Query Frame = 1
Query:    4 LREAFDLYDQDKNGLISAEELNLVLNRLGIKCSVDGCVAMIKPVDADGDGNVNFEEFRSMMTTSLK 201
            ++EAFDLYD D +G ISA E+++VL RLG K ++  C+AM++ VDADGDG V+FEEF++MM+ + K
Sbjct:   78 MKEAFDLYDIDGDGKISASEIHVVLKRLGEKQTIAECIAMVRAVDADGDGFVSFEEFKTMMSCNNK 143          
BLAST of CK935407 vs. ExPASy Swiss-Prot
Match: CML31_ARATH (Probable calcium-binding protein CML31 OS=Arabidopsis thaliana GN=CML31 PE=2 SV=2)

HSP 1 Score: 76.2554 bits (186), Expect = 7.922e-14
Identity = 35/64 (54.69%), Postives = 49/64 (76.56%), Query Frame = 1
Query:    4 LREAFDLYDQDKNGLISAEELNLVLNRLGIKCSVDGCVAMIKPVDADGDGNVNFEEFRSMMTTS 195
            ++EAFDLYD D +G ISA E+++VL RLG K +++ CV M++ VD D DG VNFEEF+ MM ++
Sbjct:   77 MKEAFDLYDMDGDGKISASEIHVVLKRLGEKHTMEDCVVMVQTVDKDSDGFVNFEEFKIMMNSN 140          
BLAST of CK935407 vs. ExPASy Swiss-Prot
Match: CML25_ARATH (Probable calcium-binding protein CML25 OS=Arabidopsis thaliana GN=CML25 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 6.706e-13
Identity = 36/62 (58.06%), Postives = 45/62 (72.58%), Query Frame = 1
Query:    4 LREAFDLYDQDKNGLISAEELNLVLNRLGIKCSVDGCVAMIKPVDADGDGNVNFEEFRSMMT 189
            L++AF +YD D NG ISAEEL+ VL  LG +CS+  C  MI  VD DGDG ++FEEF+ MMT
Sbjct:  111 LKDAFSVYDIDGNGSISAEELHEVLRSLGDECSIAECRKMIGGVDKDGDGTIDFEEFKIMMT 172          
BLAST of CK935407 vs. ExPASy Swiss-Prot
Match: CML16_ORYSJ (Probable calcium-binding protein CML16 OS=Oryza sativa subsp. japonica GN=CML16 PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.144e-12
Identity = 36/62 (58.06%), Postives = 42/62 (67.74%), Query Frame = 1
Query:    1 ELREAFDLYDQDKNGLISAEELNLVLNRLGIKCSVDGCVAMIKPVDADGDGNVNFEEFRSMM 186
            ELR AFD+YD D +G I+A EL  VL R+G  CS + C  MI  VD DGDG V FEEF+ MM
Sbjct:  104 ELRAAFDVYDVDGDGRITAAELGKVLGRIGEGCSAEECERMIASVDVDGDGCVGFEEFKKMM 165          
The following BLAST results are available for this feature:
BLAST of CK935407 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 35
Match NameE-valueIdentityDescription
CML27_ARATH4.191e-2376.92Probable calcium-binding protein CML27 OS=Arabidop... [more]
CML26_ARATH3.321e-2070.31Probable calcium-binding protein CML26 OS=Arabidop... [more]
CML18_ORYSJ6.481e-1666.13Probable calcium-binding protein CML18 OS=Oryza sa... [more]
ALL8_OLEEU6.481e-1663.49Calcium-binding allergen Ole e 8 OS=Olea europaea ... [more]
CML23_ARATH1.886e-1561.29Probable calcium-binding protein CML23 OS=Arabidop... [more]
CML24_ARATH7.165e-1560.32Calcium-binding protein CML24 OS=Arabidopsis thali... [more]
CML32_ARATH9.358e-1556.06Probable calcium-binding protein CML32 OS=Arabidop... [more]
CML31_ARATH7.922e-1454.69Probable calcium-binding protein CML31 OS=Arabidop... [more]
CML25_ARATH6.706e-1358.06Probable calcium-binding protein CML25 OS=Arabidop... [more]
CML16_ORYSJ1.144e-1258.06Probable calcium-binding protein CML16 OS=Oryza sa... [more]

Pages

back to top
Libraries
Library NameType
Developing fruit 24 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004562_A08 Developing fruit 24 DAFB Citrus sinensis cDNA clone T24DAB0001_IF_A08 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK935407 ID=CK935407|Name=CK935407|organism=Citrus sinensis|type=EST|length=474bp
GAGCTCCGCGAGGCGTTTGATCTCTACGATCAGGACAAGAACGGTTTGAT
TTCGGCGGAGGAGTTGAATTTGGTGTTGAACAGGCTCGGAATTAAGTGCT
CGGTTGATGGATGTGTGGCGATGATTAAGCCGGTGGATGCCGATGGTGAT
GGCAATGTGAATTTTGAAGAGTTTCGTTCGATGATGACTACTTCTCTTAA
ACCTGGTCCTGCGCCGTAGATTTTGGTTTCGACGGTGATTCGATGGTCGG
CCGTACCGATATCAACTTGCGTCCGTTTATAGGCTGTCGTTTTCCTCCGT
GCCTACTTGTGTCTACTACTTTTAATGTTAATAAACTCTGATGCATTTTC
AATGGTTTAAAAATTGGCTTACGATATTAATTTGACTGTACGGTCTCAAT
GAATCGATGAGTTATGATCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAA
back to top