CK935410

Overview
NameCK935410
Unique NameCK935410
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length872
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6182 contig Csv1_Contig6182:172..1043. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK935410 vs. ExPASy Swiss-Prot
Match: FB84_ARATH (F-box protein At1g70590 OS=Arabidopsis thaliana GN=At1g70590 PE=2 SV=1)

HSP 1 Score: 357.066 bits (915), Expect = 7.641e-98
Identity = 183/292 (62.67%), Postives = 218/292 (74.66%), Query Frame = 2
Query:   11 MKQRTWPDRSTGSRFTALQFPITEKDNRRPELTXXXXXXXXXXXXXFSCSRSIKS----TEGHDFASLPFDVLNKIAASFTLPQLRAASLVCKSWNDALRPLREAMVLLRWGKRFKHGRG-VRKNLDKALDSFLKGAARGSTLAMVDAGLMYWEMDKKEAAISLYRQTAVLGDPAGQFNLGISYLQAQPANAEEAVKLLYQASIAGHVRAQYQLALCLHRGRGVDFNLQEAARWYLRAAEGGYVRAMYNTSLCYSFGEGLPLSHRQARKWMKRAADCGHGKAQLEHGLGLFT 871
            MKQRTWP RS GSRF++L F      ++R  ++              S S S  S     E  DF+ LP+D+L KIAA F+ P L+AASLVCKSW DAL+PLRE+M+L+RWGK++KHGRG VR NLDKALDSFLKGA RGSTLAMVDAGL+YWE  +KE A++LYR+ + LGD  GQ NLGI+YLQ QP+N +EA+K L Q++  G+VRAQYQLALCLH GR V  NL EA +WYL+AAEGGYVRAMYN SLCYS GEGLP + + ARKWMKRAAD GH KAQ EHGL LF+
Sbjct:    1 MKQRTWPCRSEGSRFSSLSFLKPHDKDKRSRISSINKATAKSTTSSRSSSSSSSSRPPSNEFGDFSMLPYDILMKIAAPFSHPNLQAASLVCKSWRDALKPLRESMLLIRWGKKYKHGRGGVRANLDKALDSFLKGAMRGSTLAMVDAGLVYWERGEKEKAVNLYRRASELGDAVGQCNLGIAYLQVQPSNPKEAMKWLKQSAENGYVRAQYQLALCLHHGRVVQTNLLEATKWYLKAAEGGYVRAMYNISLCYSVGEGLPQNRKLARKWMKRAADHGHSKAQFEHGLALFS 292          
BLAST of CK935410 vs. ExPASy Swiss-Prot
Match: SE1L1_RAT (Protein sel-1 homolog 1 OS=Rattus norvegicus GN=Sel1l PE=2 SV=2)

HSP 1 Score: 82.0333 bits (201), Expect = 4.745e-15
Identity = 53/173 (30.64%), Postives = 88/173 (50.87%), Query Frame = 2
Query:  350 GRGVRKNLDKALDSFLKGAARGSTLAMVDAGLMYWE-----MDKKEAAISLYRQTAVLGDPAGQFNLGISYLQAQ--PANAEEAVKLLYQASIAGHVRAQYQLALCLHRGRGVDFNLQEAARWYLRAAEGGYVRAMYNTSLCYSFGEGLPLSHRQARKWMKRAADCGHGKAQL 847
            GRGV +N  +A D F   A  G++ AM   G MY E         E A+  +++ A +G+P GQ  LG++YL  +    N + A+K   +A+  G V  Q QL    + G GV  + ++A +++  A++GG++ A YN +  ++ G G+  S   A +  K   + G    +L
Sbjct:  387 GRGVEQNHQRAFDYFNLAANAGNSHAMAFLGKMYSEGSDIVPQSNETALHYFKKAADMGNPVGQSGLGMAYLYGRGVQVNYDLALKYFQKAAEQGWVDGQLQLGSMYYNGIGVKRDYKQALKYFNLASQGGHILAFYNLAQMHASGTGVMRSCHTAVELFKNVCERGRWSERL 559          
BLAST of CK935410 vs. ExPASy Swiss-Prot
Match: SE1L1_MOUSE (Protein sel-1 homolog 1 OS=Mus musculus GN=Sel1l PE=2 SV=2)

HSP 1 Score: 82.0333 bits (201), Expect = 4.745e-15
Identity = 53/173 (30.64%), Postives = 88/173 (50.87%), Query Frame = 2
Query:  350 GRGVRKNLDKALDSFLKGAARGSTLAMVDAGLMYWE-----MDKKEAAISLYRQTAVLGDPAGQFNLGISYLQAQ--PANAEEAVKLLYQASIAGHVRAQYQLALCLHRGRGVDFNLQEAARWYLRAAEGGYVRAMYNTSLCYSFGEGLPLSHRQARKWMKRAADCGHGKAQL 847
            GRGV +N  +A D F   A  G++ AM   G MY E         E A+  +++ A +G+P GQ  LG++YL  +    N + A+K   +A+  G V  Q QL    + G GV  + ++A +++  A++GG++ A YN +  ++ G G+  S   A +  K   + G    +L
Sbjct:  383 GRGVEQNHQRAFDYFNLAANAGNSHAMAFLGKMYSEGSDIVPQSNETALHYFKKAADMGNPVGQSGLGMAYLYGRGVQVNYDLALKYFQKAAEQGWVDGQLQLGSMYYNGIGVKRDYKQALKYFNLASQGGHILAFYNLAQMHASGTGVMRSCHTAVELFKNVCERGRWSERL 555          
BLAST of CK935410 vs. ExPASy Swiss-Prot
Match: SE1L1_MESAU (Protein sel-1 homolog 1 OS=Mesocricetus auratus GN=Sel1l PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 4.745e-15
Identity = 53/173 (30.64%), Postives = 88/173 (50.87%), Query Frame = 2
Query:  350 GRGVRKNLDKALDSFLKGAARGSTLAMVDAGLMYWE-----MDKKEAAISLYRQTAVLGDPAGQFNLGISYLQAQ--PANAEEAVKLLYQASIAGHVRAQYQLALCLHRGRGVDFNLQEAARWYLRAAEGGYVRAMYNTSLCYSFGEGLPLSHRQARKWMKRAADCGHGKAQL 847
            GRGV +N  +A D F   A  G++ AM   G MY E         E A+  +++ A +G+P GQ  LG++YL  +    N + A+K   +A+  G V  Q QL    + G GV  + ++A +++  A++GG++ A YN +  ++ G G+  S   A +  K   + G    +L
Sbjct:  387 GRGVEQNHQRAFDYFNLAANAGNSHAMAFLGKMYSEGSDIVPQSNETALHYFKKAADMGNPVGQSGLGMAYLYGRGIQVNYDLALKYFQKAAEQGWVDGQLQLGSMYYNGIGVKRDYKQALKYFNLASQGGHILAFYNLAQMHASGTGVMRSCHTAVELFKNVCERGRWSERL 559          
BLAST of CK935410 vs. ExPASy Swiss-Prot
Match: SE1L1_HUMAN (Protein sel-1 homolog 1 OS=Homo sapiens GN=SEL1L PE=1 SV=3)

HSP 1 Score: 82.0333 bits (201), Expect = 4.745e-15
Identity = 53/173 (30.64%), Postives = 88/173 (50.87%), Query Frame = 2
Query:  350 GRGVRKNLDKALDSFLKGAARGSTLAMVDAGLMYWE-----MDKKEAAISLYRQTAVLGDPAGQFNLGISYLQAQ--PANAEEAVKLLYQASIAGHVRAQYQLALCLHRGRGVDFNLQEAARWYLRAAEGGYVRAMYNTSLCYSFGEGLPLSHRQARKWMKRAADCGHGKAQL 847
            GRGV +N  +A D F   A  G++ AM   G MY E         E A+  +++ A +G+P GQ  LG++YL  +    N + A+K   +A+  G V  Q QL    + G GV  + ++A +++  A++GG++ A YN +  ++ G G+  S   A +  K   + G    +L
Sbjct:  387 GRGVEQNHQRAFDYFNLAANAGNSHAMAFLGKMYSEGSDIVPQSNETALHYFKKAADMGNPVGQSGLGMAYLYGRGVQVNYDLALKYFQKAAEQGWVDGQLQLGSMYYNGIGVKRDYKQALKYFNLASQGGHILAFYNLAQMHASGTGVMRSCHTAVELFKNVCERGRWSERL 559          
BLAST of CK935410 vs. ExPASy Swiss-Prot
Match: YBEQ_ECOLI (Uncharacterized protein ybeQ OS=Escherichia coli (strain K12) GN=ybeQ PE=4 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 3.759e-12
Identity = 55/182 (30.22%), Postives = 85/182 (46.70%), Query Frame = 2
Query:  332 GKRFKHGRGVRKNLDKALDSFLKGAARGSTLAMVDAGLMYWEMDKKEA-----AISLYRQTAVLGDPAGQFNLGISYLQAQPANAEEAVKLLY--QASIAGHVRAQYQLALCLHRGRGVDFNLQEAARWYLRAAEGGYVRAMYNTSLCYSFGEGLPLSHRQARKWMKRAADCGHGKAQLEHG 856
            G+++   +   K+ ++A+    K A +G T A    G   W +D+ EA     A+  Y+  A  G    Q NLG  Y        + A+   +  QA++ GH  AQ  LA     G+GV  N   AA WYL++A+ G   A +  +  Y+ GEG+   ++QA  W  +AA  G   A +  G
Sbjct:   69 GQKYTEDKSRHKDNEQAIFWLKKAALQGHTFASNALG---WTLDRGEAPNYKEAVVWYQIAAESGMSYAQNNLGWMYRNGNGVAKDYALAFFWYKQAALQGHSDAQNNLADLYEDGKGVAQNKTLAAFWYLKSAQQGNRHAQFQIAWDYNAGEGVDQDYKQAMYWYLKAAAQGSVGAYVNIG 247          

HSP 2 Score: 68.9366 bits (167), Expect = 4.156e-11
Identity = 49/169 (28.99%), Postives = 79/169 (46.75%), Query Frame = 2
Query:  353 RGVRKNLDKALDSFLKGAARGSTLAMVDAGLMYWEMD--KKEAAISL--YRQTAVLGDPAGQFNLGISYLQAQPANAEEAVKLLYQASIA--GHVRAQYQLALCLHRGRGVDFNLQEAARWYLRAAEGGYVRAMYNTSLCYSFGEGLPLSHRQARKWMKRAADCGHGKA 841
            RG   N  +A+  +   A  G + A  + G MY   +   K+ A++   Y+Q A+ G    Q NL   Y   +     + +   +    A  G+  AQ+Q+A   + G GVD + ++A  WYL+AA  G V A  N    Y  G+G+   ++ A +W  +AA+C    A
Sbjct:  110 RGEAPNYKEAVVWYQIAAESGMSYAQNNLGWMYRNGNGVAKDYALAFFWYKQAALQGHSDAQNNLADLYEDGKGVAQNKTLAAFWYLKSAQQGNRHAQFQIAWDYNAGEGVDQDYKQAMYWYLKAAAQGSVGAYVNIGYMYKHGQGVEKDYQAAFEWFTKAAECNDATA 278          
BLAST of CK935410 vs. ExPASy Swiss-Prot
Match: SE1L2_MOUSE (Protein sel-1 homolog 2 OS=Mus musculus GN=Sel1l2 PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 8.375e-12
Identity = 51/167 (30.54%), Postives = 79/167 (47.31%), Query Frame = 2
Query:  353 RGVRKNLDKALDSFLKGAARGSTLAMVDAGLMYWEMD-----KKEAAISLYRQTAVLGDPAGQFNLGISYLQAQ--PANAEEAVKLLYQASIAGHVRAQYQLALCLHRGRGVDFNLQEAARWYLRAAEGGYVRAMYNTSLCYSFGEGLPLSHRQARKWMKRAADCGH 832
            +G+ ++  KAL  FLK A  GS  AM   G MY+E +         A   +   A  G+  G   LG+ Y   +  P N  EA+K   +A+  G   AQ+QL    + G GV  + + A +++  A++ G   A+Y  +  Y+ G G+  S R A +  K   + GH
Sbjct:  312 KGLDQDYSKALYYFLKAAKAGSANAMAFIGKMYFEGNAAAPQNNATAFKYFSMAASKGNAIGLHGLGLLYFHGKGVPVNYGEALKYFQKAAEKGWPNAQFQLGFMYYSGSGVWKDYKLAFKYFYLASQSGQPLAIYYLAEMYATGTGVLRSCRTAVELYKGVCELGH 478          
BLAST of CK935410 vs. ExPASy Swiss-Prot
Match: SE1L2_HUMAN (Protein sel-1 homolog 2 OS=Homo sapiens GN=SEL1L2 PE=1 SV=2)

HSP 1 Score: 69.3218 bits (168), Expect = 3.182e-11
Identity = 53/168 (31.55%), Postives = 77/168 (45.83%), Query Frame = 2
Query:  362 RKNLD----KALDSFLKGAARGSTLAMVDAGLMYWEMD-----KKEAAISLYRQTAVLGDPAGQFNLGISYLQAQ--PANAEEAVKLLYQASIAGHVRAQYQLALCLHRGRGVDFNLQEAARWYLRAAEGGYVRAMYNTSLCYSFGEGLPLSHRQARKWMKRAADCGH 832
            RK LD    KAL  FLK A  GS  AM   G MY E +         A   +   A  G+  G   LG+ Y   +  P N  EA+K   +A+  G   AQ+QL    + G G+  + + A +++  A++ G   A+Y  +  Y+ G G+  S R A +  K   + GH
Sbjct:  311 RKGLDQDYYKALHYFLKAAKAGSANAMAFIGKMYLEGNAAVPQNNATAFKYFSMAASKGNAIGLHGLGLLYFHGKGVPLNYAEALKYFQKAAEKGWPDAQFQLGFMYYSGSGIWKDYKLAFKYFYLASQSGQPLAIYYLAKMYATGTGVVRSCRTAVELYKGVCELGH 478          
The following BLAST results are available for this feature:
BLAST of CK935410 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
FB84_ARATH7.641e-9862.67F-box protein At1g70590 OS=Arabidopsis thaliana GN... [more]
SE1L1_RAT4.745e-1530.64Protein sel-1 homolog 1 OS=Rattus norvegicus GN=Se... [more]
SE1L1_MOUSE4.745e-1530.64Protein sel-1 homolog 1 OS=Mus musculus GN=Sel1l P... [more]
SE1L1_MESAU4.745e-1530.64Protein sel-1 homolog 1 OS=Mesocricetus auratus GN... [more]
SE1L1_HUMAN4.745e-1530.64Protein sel-1 homolog 1 OS=Homo sapiens GN=SEL1L P... [more]
YBEQ_ECOLI3.759e-1230.22Uncharacterized protein ybeQ OS=Escherichia coli (... [more]
SE1L2_MOUSE8.375e-1230.54Protein sel-1 homolog 2 OS=Mus musculus GN=Sel1l2 ... [more]
SE1L2_HUMAN3.182e-1131.55Protein sel-1 homolog 2 OS=Homo sapiens GN=SEL1L2 ... [more]
back to top
Libraries
Library NameType
Developing fruit 24 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004562_A11 Developing fruit 24 DAFB Citrus sinensis cDNA clone T24DAB0001_IF_A11 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK935410 ID=CK935410|Name=CK935410|organism=Citrus sinensis|type=EST|length=872bp
GGGGGGGAAGATGAAGCAAAGAACATGGCCGGATCGATCGACCGGCTCTC
GGTTCACAGCTCTTCAATTCCCGATAACCGAGAAGGACAACCGCCGGCCA
GAACTCACCGCCAGTGCACGGAAGGCTAGAATCAAACGGCGCAGCCGCTT
CAGCTGCTCACGATCAATAAAATCAACGGAGGGTCATGATTTCGCGAGCC
TACCGTTCGATGTCTTGAACAAAATCGCAGCGTCATTCACGCTGCCTCAA
CTGAGAGCGGCGTCGCTGGTGTGCAAGTCATGGAACGACGCGCTTCGGCC
GTTGAGAGAGGCGATGGTGTTACTAAGATGGGGGAAACGATTCAAGCACG
GCCGAGGCGTCCGCAAGAACTTGGATAAGGCTCTCGACTCGTTCTTGAAA
GGCGCGGCTCGCGGCTCCACGCTTGCTATGGTTGACGCCGGACTGATGTA
TTGGGAGATGGACAAAAAGGAGGCGGCTATTAGCTTGTATCGGCAAACCG
CTGTGCTTGGAGATCCAGCTGGTCAGTTCAATTTGGGAATTTCTTATTTG
CAAGCGCAACCTGCAAATGCAGAGGAAGCTGTGAAGTTGTTGTATCAAGC
ATCGATTGCTGGCCATGTTCGAGCTCAGTATCAACTTGCACTTTGCCTGC
ATAGAGGTCGAGGAGTGGATTTCAATCTTCAAGAGGCTGCTAGGTGGTAT
TTAAGAGCTGCTGAAGGTGGCTATGTGCGTGCTATGTACAACACCTCTCT
TTGCTATTCCTTTGGGGAAGGCTTGCCACTGAGTCACAGACAAGCGAGGA
AATGGATGAAAAGAGCAGCTGATTGTGGTCACGGCAAAGCTCAACTTGAG
CATGGGCTCGGTCTATTTACGG
back to top