CK935506

Overview
NameCK935506
Unique NameCK935506
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length779
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7513 contig Csv1_Contig7513:41..748. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK935506 vs. ExPASy Swiss-Prot
Match: CYB51_ARATH (Cytochrome b5 isoform 1 OS=Arabidopsis thaliana GN=At5g53560 PE=2 SV=2)

HSP 1 Score: 178.718 bits (452), Expect = 3.096e-44
Identity = 86/129 (66.67%), Postives = 105/129 (81.40%), Query Frame = 2
Query:   92 KVHDFQEVAKHNNRDDCWLVISGKVYNVTPFLEDHPGGDEVLLAATEKDATDDFEDVGHSDSAREMMEKYHIGEIDSSSVPAKRKYTPPQQ-AVNSPEDTGSAAKILQFLVPMLILGIAFAFRYFSKKE 475
            KV  F+EV+KHN   DCWL+ISGKVY+VTPF++DHPGGDEVLL++T KDAT+DFEDVGHSD+AR+MM+KY IGEIDSSSVPA R Y  PQQ A N  +      KILQFLVP+LILG+A   R+++KK+
Sbjct:    6 KVLSFEEVSKHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFEDVGHSDTARDMMDKYFIGEIDSSSVPATRTYVAPQQPAYNQDKTPEFIIKILQFLVPILILGLALVVRHYTKKD 134          
BLAST of CK935506 vs. ExPASy Swiss-Prot
Match: CYB5_BRAOB (Cytochrome b5 OS=Brassica oleracea var. botrytis GN=CYB5 PE=1 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 2.621e-43
Identity = 85/129 (65.89%), Postives = 104/129 (80.62%), Query Frame = 2
Query:   92 KVHDFQEVAKHNNRDDCWLVISGKVYNVTPFLEDHPGGDEVLLAATEKDATDDFEDVGHSDSAREMMEKYHIGEIDSSSVPAKRKYTPP-QQAVNSPEDTGSAAKILQFLVPMLILGIAFAFRYFSKKE 475
            KV  F+EV++HN   DCWL+ISGKVY+VTPF++DHPGGDEVLL++T KDAT+DFEDVGHSD+AR+MMEKY+IGEIDSS+VPA R Y  P Q A N  +      KILQFLVP+LILG+A   R ++KKE
Sbjct:    6 KVLGFEEVSQHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFEDVGHSDTARDMMEKYYIGEIDSSTVPATRTYVAPVQPAYNQDKTPEFMIKILQFLVPILILGLALVVRQYTKKE 134          
BLAST of CK935506 vs. ExPASy Swiss-Prot
Match: CYB5_TOBAC (Cytochrome b5 OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 1.699e-42
Identity = 79/128 (61.72%), Postives = 103/128 (80.47%), Query Frame = 2
Query:   92 KVHDFQEVAKHNNRDDCWLVISGKVYNVTPFLEDHPGGDEVLLAATEKDATDDFEDVGHSDSAREMMEKYHIGEIDSSSVPAKRKYTPPQQA-VNSPEDTGSAAKILQFLVPMLILGIAFAFRYFSKK 472
            KV    EV++HNN  DCWLVISGKVY+VT FL+DHPGGDEVLL+AT KDATDDFEDVGHS SAR M+++Y++G+IDS+++P K KYTPP Q   N  + +    K+LQFLVP++ILG+AF  R+++K+
Sbjct:    6 KVFTLAEVSQHNNAKDCWLVISGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFEDVGHSSSARAMLDEYYVGDIDSATIPTKTKYTPPNQPHYNQDKTSEFVVKLLQFLVPLIILGVAFGIRFYTKQ 133          
BLAST of CK935506 vs. ExPASy Swiss-Prot
Match: CYB5_ORYSJ (Cytochrome b5 OS=Oryza sativa subsp. japonica GN=Os05g0108800 PE=2 SV=2)

HSP 1 Score: 172.17 bits (435), Expect = 2.897e-42
Identity = 79/129 (61.24%), Postives = 104/129 (80.62%), Query Frame = 2
Query:   92 KVHDFQEVAKHNNRDDCWLVISGKVYNVTPFLEDHPGGDEVLLAATEKDATDDFEDVGHSDSAREMMEKYHIGEIDSSSVPAKRKYTPPQQA-VNSPEDTGSAAKILQFLVPMLILGIAFAFRYFSKKE 475
            KV+  +EVAKHN++DDCWL+I GKVYNV+ FLEDHPGGD+VLL++T KDATDDFEDVGHS +AR MM++Y++G+ID+S++PA+ KY PP+Q   N  +      KILQFLVP+ ILG+A A R ++K E
Sbjct:    7 KVYTLEEVAKHNSKDDCWLIIGGKVYNVSKFLEDHPGGDDVLLSSTGKDATDDFEDVGHSTTARAMMDEYYVGDIDTSTIPARTKYVPPKQPHYNQDKTPEFIIKILQFLVPLAILGLAVAIRIYTKSE 135          
BLAST of CK935506 vs. ExPASy Swiss-Prot
Match: CYB5S_TOBAC (Cytochrome b5, seed isoform OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 2.897e-42
Identity = 79/129 (61.24%), Postives = 102/129 (79.07%), Query Frame = 2
Query:   89 AKVHDFQEVAKHNNRDDCWLVISGKVYNVTPFLEDHPGGDEVLLAATEKDATDDFEDVGHSDSAREMMEKYHIGEIDSSSVPAKRKYTPPQQA-VNSPEDTGSAAKILQFLVPMLILGIAFAFRYFSKK 472
            +KV    EV+ HNN  DCWL+ISGKVYNVT FLEDHPGG EVLL+AT KDATDDFED+GHS SAR M+++Y++G+IDSS++P K KYTPP+Q   N  + T    K+LQFLVP++ILG+AF   +++K+
Sbjct:    5 SKVFTLAEVSNHNNAKDCWLIISGKVYNVTKFLEDHPGGGEVLLSATGKDATDDFEDIGHSSSARAMLDEYYVGDIDSSTIPTKVKYTPPKQPHYNQDKTTEFIVKLLQFLVPLIILGVAFGVHFYTKQ 133          
BLAST of CK935506 vs. ExPASy Swiss-Prot
Match: CYB5_BOROF (Cytochrome b5 OS=Borago officinalis PE=2 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 3.203e-41
Identity = 76/129 (58.91%), Postives = 104/129 (80.62%), Query Frame = 2
Query:   86 MAKVHDFQEVAKHNNRDDCWLVISGKVYNVTPFLEDHPGGDEVLLAATEKDATDDFEDVGHSDSAREMMEKYHIGEIDSSSVPAKRKYTPPQQAVNSPEDTGS-AAKILQFLVPMLILGIAFAFRYFSK 469
            M K+    EVA+HNN  DCWL+I+GKVY+VT FLEDHPGGD+VLL+AT KDATDDFED+GHS SA+ M+++Y++G+IDSSS+P++ KYTPP+Q + +P+ T     K+LQFLVP++IL  A   R+++K
Sbjct:    1 MGKIFTLAEVAQHNNSKDCWLIINGKVYDVTKFLEDHPGGDDVLLSATGKDATDDFEDIGHSSSAKAMLDEYYVGDIDSSSIPSQVKYTPPKQPLYNPDKTREFVIKLLQFLVPLVILAGAIGIRFYTK 129          
BLAST of CK935506 vs. ExPASy Swiss-Prot
Match: CYB52_ARATH (Probable cytochrome b5 isoform 2 OS=Arabidopsis thaliana GN=At2g32720 PE=1 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 5.464e-41
Identity = 78/128 (60.94%), Postives = 101/128 (78.91%), Query Frame = 2
Query:   89 AKVHDFQEVAKHNNRDDCWLVISGKVYNVTPFLEDHPGGDEVLLAATEKDATDDFEDVGHSDSAREMMEKYHIGEIDSSSVPAKRKYTPPQQA-VNSPEDTGSAAKILQFLVPMLILGIAFAFRYFSK 469
            AK+    EV++HN   DCW+VI+GKVYNVT FLEDHPGGD+VLL++T KDATDDFEDVGHS+SAREMME+Y++GEID +++P K KYTPP+Q   N  + +    K+LQFLVP+ ILG+A   R ++K
Sbjct:    5 AKIFTLSEVSEHNQAHDCWIVINGKVYNVTKFLEDHPGGDDVLLSSTGKDATDDFEDVGHSESAREMMEQYYVGEIDPTTIPKKVKYTPPKQPHYNQDKTSEFIIKLLQFLVPLAILGLAVGIRIYTK 132          
BLAST of CK935506 vs. ExPASy Swiss-Prot
Match: CYB5_CUSRE (Cytochrome b5 OS=Cuscuta reflexa PE=2 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 1.260e-37
Identity = 71/129 (55.04%), Postives = 100/129 (77.52%), Query Frame = 2
Query:   89 AKVHDFQEVAKHNNRDDCWLVISGKVYNVTPFLEDHPGGDEVLLAATEKDATDDFEDVGHSDSAREMMEKYHIGEIDSSSVPAKRKYTPPQQAVNSPEDTGS-AAKILQFLVPMLILGIAFAFRYFSKK 472
            +KV+   EV++H+  +DCWLVI GKVY+VT FL+DHPGG +VLL++T KDATDDFED+GHS SAR MM++  +G+IDSS++P K  YTPP+Q + + + T     K+LQFLVP++ILG+A   R++ K+
Sbjct:    4 SKVYSLAEVSEHSQPNDCWLVIGGKVYDVTKFLDDHPGGADVLLSSTAKDATDDFEDIGHSSSARAMMDEMCVGDIDSSTIPTKTSYTPPKQPLYNQDKTPQFIIKLLQFLVPLIILGVAVGIRFYKKQ 132          
BLAST of CK935506 vs. ExPASy Swiss-Prot
Match: CYB5_DROME (Cytochrome b5 OS=Drosophila melanogaster GN=Cyt-b5 PE=2 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 1.266e-21
Identity = 53/119 (44.54%), Postives = 74/119 (62.18%), Query Frame = 2
Query:  110 EVAKHNNRDDCWLVISGKVYNVTPFLEDHPGGDEVLLAATEKDATDDFEDVGHSDSAREMMEKYHIGE-IDSSSVPAKRKYTPPQQAVNSPEDTGSAAKILQFLVPMLILGIAFAFRYF 463
            EVAKHN   D WL+I   +Y+VT FL +HPGG+EVL+    KDAT++FEDVGHS+ AR+MM+KY IGE ++S      +K  P      S E     + +  +LVP+++  +A  F  F
Sbjct:   13 EVAKHNTNKDTWLLIHNNIYDVTAFLNEHPGGEEVLIEQAGKDATENFEDVGHSNDARDMMKKYKIGELVESERTSVAQKSEPTW----STEQQTEESSVKSWLVPLVLCLVATLFYKF 127          
BLAST of CK935506 vs. ExPASy Swiss-Prot
Match: CYB5_RHIST (Cytochrome b5 OS=Rhizopus stolonifer PE=2 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 4.809e-21
Identity = 51/124 (41.13%), Postives = 76/124 (61.29%), Query Frame = 2
Query:   89 AKVHDFQEVAKHNNRDDCWLVISGKVYNVTPFLEDHPGGDEVLLAATEKDATDDFEDVGHSDSAREMMEKYHIGEIDSSSVPAKRKYTPPQQAVNSPEDTGSAAKILQFLVPMLILGIAFAFRY 460
            AK+    EV+KH  + D W+VI  KVY++T F+ +HPGG+EVL+    KDAT+ FED+GHSD AREM+E+Y IG +D +S   +      +      E  GS+   L+ ++P L +  A  ++Y
Sbjct:    3 AKIFSLDEVSKHKTKSDLWVVIHNKVYDITRFVVEHPGGEEVLVDEGGKDATEAFEDIGHSDEAREMLEEYLIGSLDEASRTKEYNVNVIRAGELPEEKKGSS---LRIILPALAIIGALVYKY 123          
The following BLAST results are available for this feature:
BLAST of CK935506 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 70
Match NameE-valueIdentityDescription
CYB51_ARATH3.096e-4466.67Cytochrome b5 isoform 1 OS=Arabidopsis thaliana GN... [more]
CYB5_BRAOB2.621e-4365.89Cytochrome b5 OS=Brassica oleracea var. botrytis G... [more]
CYB5_TOBAC1.699e-4261.72Cytochrome b5 OS=Nicotiana tabacum PE=2 SV=1[more]
CYB5_ORYSJ2.897e-4261.24Cytochrome b5 OS=Oryza sativa subsp. japonica GN=O... [more]
CYB5S_TOBAC2.897e-4261.24Cytochrome b5, seed isoform OS=Nicotiana tabacum P... [more]
CYB5_BOROF3.203e-4158.91Cytochrome b5 OS=Borago officinalis PE=2 SV=1[more]
CYB52_ARATH5.464e-4160.94Probable cytochrome b5 isoform 2 OS=Arabidopsis th... [more]
CYB5_CUSRE1.260e-3755.04Cytochrome b5 OS=Cuscuta reflexa PE=2 SV=1[more]
CYB5_DROME1.266e-2144.54Cytochrome b5 OS=Drosophila melanogaster GN=Cyt-b5... [more]
CYB5_RHIST4.809e-2141.13Cytochrome b5 OS=Rhizopus stolonifer PE=2 SV=1[more]

Pages

back to top
Libraries
Library NameType
Developing fruit 24 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004554_G12 Developing fruit 24 DAFB Citrus sinensis cDNA clone T24DAB0004_IIIF_G12 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK935506 ID=CK935506|Name=CK935506|organism=Citrus sinensis|type=EST|length=779bp
GGGGGTTTTCTTACGGACTGTTAATGTTGACTTTAATAGATAATTCTGAT
TCTGCGTGAGCAGTAGCTGAAATAGCCAGAAAAGAATGGCCAAAGTTCAT
GATTTTCAAGAGGTGGCAAAGCACAATAATAGAGATGATTGTTGGCTTGT
AATTTCTGGAAAGGTCTATAATGTGACTCCGTTTCTCGAAGATCATCCTG
GTGGTGATGAAGTCTTGCTAGCTGCTACTGAGAAGGATGCAACAGACGAC
TTTGAAGATGTGGGTCACAGCGATTCTGCCAGAGAGATGATGGAAAAATA
CCACATTGGTGAGATTGATAGCTCCAGTGTTCCAGCAAAAAGGAAGTACA
CTCCACCCCAACAAGCAGTTAATAGTCCCGAAGACACTGGATCTGCAGCA
AAGATTCTACAGTTCCTGGTACCGATGTTGATCCTGGGCATAGCATTTGC
TTTCCGTTACTTTTCCAAGAAAGAAGAGTGAAGCATTGTATGAATTGCAA
AACCGAACCAGATACCTCTTCGTTAGTTTACTACCTATCCTATAGTATTA
GAACTTCAATTGGCACTTGGTATCAGGATTTGTTTTGATACTAAACTATG
TGTAGCAATAATAATTGGTGCTTCGTGCATCCTCGTTGAAGGATGTGATA
AAAGTTATACTGAAGCAATAATACAGTGAAATTGAACGCAAAAAAAGAAA
AAAAAAATCATTGTATTGTGAAATATTTAGTAATTATCACTTGTATGTAC
AAAAAAAAAAAAAAAAAAAAAAAAAAAAA
back to top