CK935508

Overview
NameCK935508
Unique NameCK935508
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length718
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1825 contig Csv1_Contig1825:1..718. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS23_FRAAN (40S ribosomal protein S23 OS=Fragaria ananassa GN=RPS23 PE=2 SV=1)

HSP 1 Score: 282.337 bits (721), Expect = 1.733e-75
Identity = 139/142 (97.89%), Postives = 140/142 (98.59%), Query Frame = 2
Query:   98 MRKTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKKPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 523
            M KTRGMGA RKLK+HRRRQRWADKSYKKSHLGNEWKKPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct:    1 MGKTRGMGAARKLKNHRRRQRWADKSYKKSHLGNEWKKPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 142          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS23_EUPES (40S ribosomal protein S23 OS=Euphorbia esula GN=RPS23 PE=2 SV=1)

HSP 1 Score: 279.256 bits (713), Expect = 1.467e-74
Identity = 138/142 (97.18%), Postives = 138/142 (97.18%), Query Frame = 2
Query:   98 MRKTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKKPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 523
            M KT GMGA RKLKSHRR QRWADKSYKKSHLGNEWKKPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct:    1 MGKTHGMGAARKLKSHRRTQRWADKSYKKSHLGNEWKKPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 142          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS232_ARATH (40S ribosomal protein S23-2 OS=Arabidopsis thaliana GN=RPS23B PE=2 SV=2)

HSP 1 Score: 273.092 bits (697), Expect = 1.051e-72
Identity = 136/142 (95.77%), Postives = 136/142 (95.77%), Query Frame = 2
Query:   98 MRKTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKKPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 523
            M KTRGMGAGRKLK  R  QRWADK YKKSHLGNEWKKPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct:    1 MGKTRGMGAGRKLKRLRINQRWADKQYKKSHLGNEWKKPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 142          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS231_ARATH (40S ribosomal protein S23-1 OS=Arabidopsis thaliana GN=RPS23A PE=2 SV=2)

HSP 1 Score: 264.233 bits (674), Expect = 4.884e-70
Identity = 133/142 (93.66%), Postives = 134/142 (94.37%), Query Frame = 2
Query:   98 MRKTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKKPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 523
            M KTRGMGAGRKLK  R  QRWADK YKKS+ GNEWKKPFA SSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct:    1 MGKTRGMGAGRKLKQLRITQRWADKHYKKSNRGNEWKKPFACSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 142          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS23_LUMRU (40S ribosomal protein S23 OS=Lumbricus rubellus GN=RPS23 PE=2 SV=1)

HSP 1 Score: 239.965 bits (611), Expect = 9.863e-63
Identity = 115/143 (80.42%), Postives = 126/143 (88.11%), Query Frame = 2
Query:   98 MRKTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKK-PFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 523
            M K RG+   RKLK+HRR QRW DK YKKSHLG  WK  PF G+SHAKGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVP DGCLN+IEENDEVL+AGFGRKGHAVGDIPGVRFKVVKV+ VSLLAL+K+KKE+PRS
Sbjct:    1 MGKPRGLRTARKLKNHRREQRWHDKDYKKSHLGTRWKSNPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNFIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVASVSLLALYKQKKERPRS 143          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS23_DERVA (40S ribosomal protein S23 OS=Dermacentor variabilis GN=RpS23 PE=2 SV=1)

HSP 1 Score: 238.039 bits (606), Expect = 3.748e-62
Identity = 115/143 (80.42%), Postives = 125/143 (87.41%), Query Frame = 2
Query:   98 MRKTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWK-KPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 523
            M K RG+   RK +SHRR QRW DK YKK+HLG  WK  PF G+SHAKGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVP DGCLNYIEENDEVL+AGFGRKGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct:    1 MGKPRGLRTARKHRSHRRDQRWHDKDYKKAHLGTRWKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNYIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 143          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS23_SPOFR (40S ribosomal protein S23 OS=Spodoptera frugiperda GN=RpS23 PE=2 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 3.173e-61
Identity = 112/143 (78.32%), Postives = 125/143 (87.41%), Query Frame = 2
Query:   98 MRKTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWK-KPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 523
            M K RG+   RK  +HRR QRWADK YKK+H+G  WK  PF G+SHAKGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKK+ AFVP DGCLN+IEENDEVL+AGFGRKGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct:    1 MGKPRGIRTARKHVNHRREQRWADKDYKKAHMGTRWKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 143          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS23_PAPDA (40S ribosomal protein S23 OS=Papilio dardanus GN=RpS23 PE=2 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 3.173e-61
Identity = 112/143 (78.32%), Postives = 125/143 (87.41%), Query Frame = 2
Query:   98 MRKTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWK-KPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 523
            M K RG+   RK  +HRR QRWADK YKK+H+G  WK  PF G+SHAKGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKK+ AFVP DGCLN+IEENDEVL+AGFGRKGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct:    1 MGKPRGIRTARKHVNHRREQRWADKDYKKAHMGTRWKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 143          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS23_DROME (40S ribosomal protein S23 OS=Drosophila melanogaster GN=RpS23 PE=2 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 7.068e-61
Identity = 114/143 (79.72%), Postives = 124/143 (86.71%), Query Frame = 2
Query:   98 MRKTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWK-KPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 523
            M K RG+   RK  +HRR QRWADK YKK+HLG  WK  PF G+SHAKGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVP DG LNYIEENDEVL+AGFGRKGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct:    1 MGKPRGLRTARKHVNHRRDQRWADKDYKKAHLGTRWKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGSLNYIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 143          
BLAST of CK935508 vs. ExPASy Swiss-Prot
Match: RS23_BRUMA (40S ribosomal protein S23 OS=Brugia malayi GN=rps-23 PE=2 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 1.206e-60
Identity = 111/143 (77.62%), Postives = 125/143 (87.41%), Query Frame = 2
Query:   98 MRKTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWK-KPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 523
            M K +G+ A RKLK+HR+ QRW DK YKK+HLG  WK  PF  +SHAKGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGRKGHAVGDIPGVRFK+VKV+  SL+ALFK KKE+PRS
Sbjct:    1 MGKPKGIRAARKLKTHRQAQRWNDKGYKKAHLGTRWKANPFGTASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGRKGHAVGDIPGVRFKIVKVANTSLIALFKGKKERPRS 143          
The following BLAST results are available for this feature:
BLAST of CK935508 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 78
Match NameE-valueIdentityDescription
RS23_FRAAN1.733e-7597.8940S ribosomal protein S23 OS=Fragaria ananassa GN=... [more]
RS23_EUPES1.467e-7497.1840S ribosomal protein S23 OS=Euphorbia esula GN=RP... [more]
RS232_ARATH1.051e-7295.7740S ribosomal protein S23-2 OS=Arabidopsis thalian... [more]
RS231_ARATH4.884e-7093.6640S ribosomal protein S23-1 OS=Arabidopsis thalian... [more]
RS23_LUMRU9.863e-6380.4240S ribosomal protein S23 OS=Lumbricus rubellus GN... [more]
RS23_DERVA3.748e-6280.4240S ribosomal protein S23 OS=Dermacentor variabili... [more]
RS23_SPOFR3.173e-6178.3240S ribosomal protein S23 OS=Spodoptera frugiperda... [more]
RS23_PAPDA3.173e-6178.3240S ribosomal protein S23 OS=Papilio dardanus GN=R... [more]
RS23_DROME7.068e-6179.7240S ribosomal protein S23 OS=Drosophila melanogast... [more]
RS23_BRUMA1.206e-6077.6240S ribosomal protein S23 OS=Brugia malayi GN=rps-... [more]

Pages

back to top
Libraries
Library NameType
Developing fruit 24 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004554_H02 Developing fruit 24 DAFB Citrus sinensis cDNA clone T24DAB0004_IIIF_H02 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK935508 ID=CK935508|Name=CK935508|organism=Citrus sinensis|type=EST|length=718bp
GGAGGAGGGTTTTGGCNNNTTACTCGCGGCGTCCTCTTGCAACTCTCAAG
CTCCAAAGTCGTTCGTTACAGTAAAAAATCCTCTTCGTAACGCCAACATG
AGGAAGACACGTGGAATGGGAGCTGGTCGCAAGCTGAAGAGCCACCGCAG
AAGACAAAGGTGGGCTGATAAGTCATACAAGAAATCCCACCTTGGCAATG
AATGGAAGAAGCCATTTGCTGGCTCTTCCCATGCAAAAGGCATTGTTCTT
GAGAAAATCGGTATCGAGGCAAAGCAGCCCAACTCTGCTATCAGAAAATG
CGCTCGAGTTCAGCTGATCAAGAATGGAAAGAAGATTGCAGCTTTCGTAC
CAAACGATGGTTGTTTGAACTACATTGAAGAAAATGACGAGGTACTTATT
GCAGGATTTGGTCGAAAGGGGCATGCTGTGGGAGATATTCCTGGTGTTAG
ATTTAAGGTTGTCAAGGTTTCAGGCGTGTCTCTTCTGGCCCTCTTCAAGG
AGAAGAAGGAGAAACCAAGATCCTAAACTCCTGATTCAAGATACTTCACC
ATGTTTTCTTTTTTTAGCACTTTATTTTCATTAGTCCCTGTTGATTACTT
TTTTCCTTTATCATGTATTGCTGTTGTGAGAACTTTTTGGTTTTTTTCCC
TCTGTTGAGACTGTTAGTAAATTAGTATCTGTCTCTTTAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAA
back to top