EY756568

Overview
NameEY756568
Unique NameEY756568
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length520
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9691 contig Csv1_Contig9691:286..804. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756568 vs. ExPASy Swiss-Prot
Match: USP_PEA (UDP-sugar pyrophospharylase OS=Pisum sativum GN=USP PE=1 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 3.868e-18
Identity = 42/60 (70.00%), Postives = 47/60 (78.33%), Query Frame = 2
Query:   11 AVDYPEVRVGGKVQNKGWTLEPVDHKDTSVPEEIRIRGFKINKLEQLEKSYSEPGKFSLK 190
            AVD  EV V G VQN GW LEPVD+KD+S PE +RIRGFK NK+EQ+EK YSEPGKF  K
Sbjct:  540 AVDDAEVNVSGSVQNNGWALEPVDYKDSSEPEVLRIRGFKFNKVEQVEKKYSEPGKFDFK 599          
BLAST of EY756568 vs. ExPASy Swiss-Prot
Match: USP_ARATH (UDP-sugar pyrophosphorylase OS=Arabidopsis thaliana GN=USP PE=1 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.470e-17
Identity = 38/60 (63.33%), Postives = 52/60 (86.67%), Query Frame = 2
Query:   11 AVDYPEVRVGGKVQNKGWTLEPVDHKDTSVPEEIRIRGFKINKLEQLEKSYSEPGKFSLK 190
            ++D  EV++GG ++N GWT+E VD+KDTSVPEEIRIRGF+ NK+EQLEK  ++PGKFS++
Sbjct:  554 SIDDAEVKLGGLIKNNGWTMESVDYKDTSVPEEIRIRGFRFNKVEQLEKKLTQPGKFSVE 613          
BLAST of EY756568 vs. ExPASy Swiss-Prot
Match: USP1_SOYBN (UDP-sugar pyrophosphorylase 1 OS=Glycine max GN=USP1 PE=1 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 3.275e-17
Identity = 42/60 (70.00%), Postives = 45/60 (75.00%), Query Frame = 2
Query:   11 AVDYPEVRVGGKVQNKGWTLEPVDHKDTSVPEEIRIRGFKINKLEQLEKSYSEPGKFSLK 190
            AVD  EV V G VQN GW LE VD+KD S PE +RIRGFK NK+EQLE  YSEPGKF LK
Sbjct:  540 AVDDAEVNVSGSVQNNGWVLETVDYKDASEPEVLRIRGFKFNKIEQLETKYSEPGKFHLK 599          
BLAST of EY756568 vs. ExPASy Swiss-Prot
Match: USP_CUCME (UDP-sugar pyrophospharylase OS=Cucumis melo GN=USP PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 4.426e-14
Identity = 35/45 (77.78%), Postives = 41/45 (91.11%), Query Frame = 2
Query:   26 EVRVGGKVQNKGWTLEPVDHKDTSVPEEIRIRGFKINKLEQLEKS 160
            EV+V G V NKGWTLEPVD+KDTSVPEEIRIRGF+INK+EQ E++
Sbjct:  570 EVKVEGSVHNKGWTLEPVDYKDTSVPEEIRIRGFRINKIEQEERN 614          
BLAST of EY756568 vs. ExPASy Swiss-Prot
Match: USP_ORYSJ (UDP-sugar pyrophosphorylase OS=Oryza sativa subsp. japonica GN=USP PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 7.066e-12
Identity = 32/52 (61.54%), Postives = 40/52 (76.92%), Query Frame = 2
Query:    8 SAVDYPEVRVGGKVQNKGWTLEPVDHKDTSVPEEIRIRGFKINKLEQLEKSY 163
            +A D  +  V G ++NKGWT++ VDHKDTS  EEIRIRGFK NK+EQLE +Y
Sbjct:  565 NAKDEAKFNVTGHIENKGWTIQHVDHKDTSEKEEIRIRGFKFNKVEQLELNY 616          
BLAST of EY756568 vs. ExPASy Swiss-Prot
Match: USP_ORYSI (UDP-sugar pyrophosphorylase OS=Oryza sativa subsp. indica GN=USP PE=3 SV=2)

HSP 1 Score: 70.0922 bits (170), Expect = 7.066e-12
Identity = 32/52 (61.54%), Postives = 40/52 (76.92%), Query Frame = 2
Query:    8 SAVDYPEVRVGGKVQNKGWTLEPVDHKDTSVPEEIRIRGFKINKLEQLEKSY 163
            +A D  +  V G ++NKGWT++ VDHKDTS  EEIRIRGFK NK+EQLE +Y
Sbjct:  565 NAKDEAKFNVTGHIENKGWTIQHVDHKDTSEKEEIRIRGFKFNKVEQLELNY 616          
The following BLAST results are available for this feature:
BLAST of EY756568 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
USP_PEA3.868e-1870.00UDP-sugar pyrophospharylase OS=Pisum sativum GN=US... [more]
USP_ARATH1.470e-1763.33UDP-sugar pyrophosphorylase OS=Arabidopsis thalian... [more]
USP1_SOYBN3.275e-1770.00UDP-sugar pyrophosphorylase 1 OS=Glycine max GN=US... [more]
USP_CUCME4.426e-1477.78UDP-sugar pyrophospharylase OS=Cucumis melo GN=USP... [more]
USP_ORYSJ7.066e-1261.54UDP-sugar pyrophosphorylase OS=Oryza sativa subsp.... [more]
USP_ORYSI7.066e-1261.54UDP-sugar pyrophosphorylase OS=Oryza sativa subsp.... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-010-B01-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756568 ID=EY756568|Name=EY756568|organism=Citrus sinensis|type=EST|length=520bp
CCACGCGTCCGCTGTTGACTATCCAGAGGTGAGAGTAGGAGGTAAAGTGC
AGAACAAGGGCTGGACACTTGAACCTGTTGACCACAAAGATACTTCAGTG
CCCGAGGAAATACGGATCCGGGGTTTCAAGATCAACAAACTTGAGCAGCT
GGAAAAGAGTTACAGTGAGCCCGGCAAGTTTAGCTTGAAGCCTTGAAGGG
TTAACATGTACATTACAACTATTCATCTGACCTTTTGGGTCCAATTACTC
TTTTAACTTGTAATGAGTTTTTAATCCCGTCACTCCCGGTGCGGGGATTG
ATGCCTTATTTCCCCGAGTAGTTATTCTGTAAAAGTTTGTCTTCGAACCA
GTTTTCCTTCTGGAGATTATGGTATGCGTCTATTTAGGCTAAAAATGTTG
CATACTCTTAATTTTTTCGATTCTTTCTCATTCTAGACAAAGAATAAAAT
CTGTTCATAGTGTCAGATATTATATTCAGAACTGTTTTTACCGTGCAGTT
TAAGCAAAAAAAAAAAAAAA
back to top