EY756567

Overview
NameEY756567
Unique NameEY756567
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length916
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY756567_ssr261 microsatellite EY756567_ssr261:261..275. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig13239 contig Csv1_Contig13239:336..1253. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756567 vs. ExPASy Swiss-Prot
Match: FDH_SOLTU (Formate dehydrogenase, mitochondrial OS=Solanum tuberosum GN=FDH1 PE=1 SV=2)

HSP 1 Score: 469.159 bits (1206), Expect = 1.721e-145
Identity = 226/262 (86.26%), Postives = 242/262 (92.37%), Query Frame = 1
Query:   13 NFLGCVEGGCGLREWLESKGHLYLVTDDKEGPDCELEKHIPDLHVLISTPFHPAYVTAERIKKAKNLQLLLTAGVGSDHIDLNXXXXXGLTVAEVTGSNVVSVAEDELMRILILVRNFLPGHHQVISGEWNVAGVAYRAYDLEGKTVGTVGCGRIGKLLLQRLKPFNCNLLYHDRVKMDPQLEKETGAKFEEDLDTMLPKCDIVVVNTPLTEKTRGMFDKDRIAKMKKGVLIVNNARGAIMDTQAVVDACSSGHIAGYSGDV 798
            NFLGC E   G+REWLESKGH Y+VT DKEGPDCELEKHIPDLHVLISTPFHPAYVTAERIKKAKNLQLLLTAG+GSDH+DL      GLTVAEVTGSN VSVAEDELMRILILVRNFLPGHHQVI+GEWNVA +A+RAYDLEGKTVGTVG GRIG+LLLQRLKPFNCNLLYHDR+KMD +LE + GAKFEEDLD ML KCDIVV+NTPLTEKT+GMFDK+RIAK+KKGVLIVNNARGAIMDTQAVVDAC+SGHIAGYSGDV
Sbjct:   51 NFLGCAENALGIREWLESKGHQYIVTPDKEGPDCELEKHIPDLHVLISTPFHPAYVTAERIKKAKNLQLLLTAGIGSDHVDLKAAAAAGLTVAEVTGSNTVSVAEDELMRILILVRNFLPGHHQVINGEWNVAAIAHRAYDLEGKTVGTVGAGRIGRLLLQRLKPFNCNLLYHDRLKMDSELENQIGAKFEEDLDKMLSKCDIVVINTPLTEKTKGMFDKERIAKLKKGVLIVNNARGAIMDTQAVVDACNSGHIAGYSGDV 312          

HSP 2 Score: 68.5514 bits (166), Expect = 1.721e-145
Identity = 29/33 (87.88%), Postives = 30/33 (90.91%), Query Frame = 2
Query:  818 KGHPWRYMPNQAMTPHVSGTTXDAQLRYAAGVK 916
            K HPWRYMPNQAMTPH+SGTT DAQLRYAAG K
Sbjct:  320 KDHPWRYMPNQAMTPHISGTTIDAQLRYAAGTK 352          
BLAST of EY756567 vs. ExPASy Swiss-Prot
Match: FDH1_ORYSJ (Formate dehydrogenase 1, mitochondrial OS=Oryza sativa subsp. japonica GN=Os06g0486800 PE=1 SV=2)

HSP 1 Score: 453.366 bits (1165), Expect = 1.236e-140
Identity = 216/262 (82.44%), Postives = 241/262 (91.98%), Query Frame = 1
Query:   13 NFLGCVEGGCGLREWLESKGHLYLVTDDKEGPDCELEKHIPDLHVLISTPFHPAYVTAERIKKAKNLQLLLTAGVGSDHIDLNXXXXXGLTVAEVTGSNVVSVAEDELMRILILVRNFLPGHHQVISGEWNVAGVAYRAYDLEGKTVGTVGCGRIGKLLLQRLKPFNCNLLYHDRVKMDPQLEKETGAKFEEDLDTMLPKCDIVVVNTPLTEKTRGMFDKDRIAKMKKGVLIVNNARGAIMDTQAVVDACSSGHIAGYSGDV 798
            NF+GCVEG  G+REWLESKGH Y+VTDDKEG + ELEKHI D+HVLI+TPFHPAYV+AERIKKAKNL+LLLTAG+GSDHIDL      GLTVAEVTGSN VSVAEDELMRILIL+RNFLPG+ QV+ GEWNVAG+AYRAYDLEGKTVGTVG GRIG+LLLQRLKPFNCNLLYHDR+K+DP+LEKE GAK+EEDLD MLPKCD++V+NTPLTEKTRGMF+K+RIAKMKKGV+IVNNARGAIMDTQAV DACSSG +AGY GDV
Sbjct:   46 NFVGCVEGALGIREWLESKGHHYIVTDDKEGLNSELEKHIEDMHVLITTPFHPAYVSAERIKKAKNLELLLTAGIGSDHIDLPAAAAAGLTVAEVTGSNTVSVAEDELMRILILLRNFLPGYQQVVHGEWNVAGIAYRAYDLEGKTVGTVGAGRIGRLLLQRLKPFNCNLLYHDRLKIDPELEKEIGAKYEEDLDAMLPKCDVIVINTPLTEKTRGMFNKERIAKMKKGVIIVNNARGAIMDTQAVADACSSGQVAGYGGDV 307          

HSP 2 Score: 68.1662 bits (165), Expect = 1.236e-140
Identity = 29/33 (87.88%), Postives = 30/33 (90.91%), Query Frame = 2
Query:  818 KGHPWRYMPNQAMTPHVSGTTXDAQLRYAAGVK 916
            K HPWRYMPN AMTPH+SGTT DAQLRYAAGVK
Sbjct:  315 KDHPWRYMPNHAMTPHISGTTIDAQLRYAAGVK 347          
BLAST of EY756567 vs. ExPASy Swiss-Prot
Match: FDH_ARATH (Formate dehydrogenase, mitochondrial OS=Arabidopsis thaliana GN=FDH1 PE=1 SV=1)

HSP 1 Score: 450.284 bits (1157), Expect = 1.357e-139
Identity = 215/262 (82.06%), Postives = 239/262 (91.22%), Query Frame = 1
Query:   13 NFLGCVEGGCGLREWLESKGHLYLVTDDKEGPDCELEKHIPDLHVLISTPFHPAYVTAERIKKAKNLQLLLTAGVGSDHIDLNXXXXXGLTVAEVTGSNVVSVAEDELMRILILVRNFLPGHHQVISGEWNVAGVAYRAYDLEGKTVGTVGCGRIGKLLLQRLKPFNCNLLYHDRVKMDPQLEKETGAKFEEDLDTMLPKCDIVVVNTPLTEKTRGMFDKDRIAKMKKGVLIVNNARGAIMDTQAVVDACSSGHIAGYSGDV 798
            NFLGCVE   G+R+WLES+GH Y+VTDDKEGPDCELEKHIPDLHVLISTPFHPAYVTAERIKKAKNL+LLLTAG+GSDHIDL      GLTVAEVTGSNVVSVAEDELMRILIL+RNF+PG++QV+ GEWNVAG+AYRAYDLEGKT+GTVG GRIGKLLLQRLKPF CNLLYHDR++M P+LEKETGAKF EDL+ MLPKCD++V+N PLTEKTRGMF+K+ I K+KKGVLIVNNARGAIM+ QAVVDA  SGHI GYSGDV
Sbjct:   54 NFLGCVENALGIRDWLESQGHQYIVTDDKEGPDCELEKHIPDLHVLISTPFHPAYVTAERIKKAKNLKLLLTAGIGSDHIDLQAAAAAGLTVAEVTGSNVVSVAEDELMRILILMRNFVPGYNQVVKGEWNVAGIAYRAYDLEGKTIGTVGAGRIGKLLLQRLKPFGCNLLYHDRLQMAPELEKETGAKFVEDLNEMLPKCDVIVINMPLTEKTRGMFNKELIGKLKKGVLIVNNARGAIMERQAVVDAVESGHIGGYSGDV 315          

HSP 2 Score: 67.781 bits (164), Expect = 1.357e-139
Identity = 29/41 (70.73%), Postives = 33/41 (80.49%), Query Frame = 2
Query:  794 MFESTTSSKGHPWRYMPNQAMTPHVSGTTXDAQLRYAAGVK 916
            +++   + K HPWRYMPNQAMTPH SGTT DAQLRYAAG K
Sbjct:  315 VWDPQPAPKDHPWRYMPNQAMTPHTSGTTIDAQLRYAAGTK 355          
BLAST of EY756567 vs. ExPASy Swiss-Prot
Match: FDH2_ORYSJ (Formate dehydrogenase 2, mitochondrial OS=Oryza sativa subsp. japonica GN=Os06g0486900 PE=2 SV=1)

HSP 1 Score: 451.055 bits (1159), Expect = 5.137e-139
Identity = 211/262 (80.53%), Postives = 239/262 (91.22%), Query Frame = 1
Query:   13 NFLGCVEGGCGLREWLESKGHLYLVTDDKEGPDCELEKHIPDLHVLISTPFHPAYVTAERIKKAKNLQLLLTAGVGSDHIDLNXXXXXGLTVAEVTGSNVVSVAEDELMRILILVRNFLPGHHQVISGEWNVAGVAYRAYDLEGKTVGTVGCGRIGKLLLQRLKPFNCNLLYHDRVKMDPQLEKETGAKFEEDLDTMLPKCDIVVVNTPLTEKTRGMFDKDRIAKMKKGVLIVNNARGAIMDTQAVVDACSSGHIAGYSGDV 798
            NF+GCV+   G+R WLESKGH Y+VTDDKEG +CELEKHI D HVLI+TPFHPAY+TAERIKKAKNL+LLLTAGVGSDHIDL      GLTVAE+TGSN VSVAED+LMRIL+L+RNFLPGHHQ+++GEWNVAG+A+R YDLEGKTVGTVG GRIG+LLLQRLKPFNCNL+YHDRVK+DP+LEKE GAK+EEDLD MLPKCD+VV+N PLTEKTRGMF+K+RIAKMKKGV IVNNARGAIMDTQAV DAC+SGH+AGY GDV
Sbjct:   48 NFVGCVDSALGIRGWLESKGHRYIVTDDKEGINCELEKHIEDAHVLITTPFHPAYITAERIKKAKNLELLLTAGVGSDHIDLPAAAAAGLTVAEITGSNTVSVAEDQLMRILLLLRNFLPGHHQIVNGEWNVAGIAHRTYDLEGKTVGTVGAGRIGRLLLQRLKPFNCNLMYHDRVKIDPELEKEIGAKYEEDLDAMLPKCDVVVINMPLTEKTRGMFNKERIAKMKKGVTIVNNARGAIMDTQAVADACASGHVAGYGGDV 309          

HSP 2 Score: 65.0846 bits (157), Expect = 5.137e-139
Identity = 28/33 (84.85%), Postives = 28/33 (84.85%), Query Frame = 2
Query:  818 KGHPWRYMPNQAMTPHVSGTTXDAQLRYAAGVK 916
            K HPWRYMPN AMTPH SGTT D QLRYAAGVK
Sbjct:  317 KDHPWRYMPNHAMTPHCSGTTIDGQLRYAAGVK 349          
BLAST of EY756567 vs. ExPASy Swiss-Prot
Match: FDH_HORVU (Formate dehydrogenase, mitochondrial OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 442.195 bits (1136), Expect = 2.786e-137
Identity = 211/262 (80.53%), Postives = 238/262 (90.84%), Query Frame = 1
Query:   13 NFLGCVEGGCGLREWLESKGHLYLVTDDKEGPDCELEKHIPDLHVLISTPFHPAYVTAERIKKAKNLQLLLTAGVGSDHIDLNXXXXXGLTVAEVTGSNVVSVAEDELMRILILVRNFLPGHHQVISGEWNVAGVAYRAYDLEGKTVGTVGCGRIGKLLLQRLKPFNCNLLYHDRVKMDPQLEKETGAKFEEDLDTMLPKCDIVVVNTPLTEKTRGMFDKDRIAKMKKGVLIVNNARGAIMDTQAVVDACSSGHIAGYSGDV 798
            NF+GCVEG  G+R+WLESKGH Y+VTDDKEG + ELEKHI D+HVLI+TPFHPAYVTAE+IKKAK  +LLLTAG+GSDHIDL      GLTVA VTGSN VSVAEDELMRILIL+RNFLPG+ QV+ GEWNVAG+A+RAYDLEGKTVGTVG GR G+LLLQRLKPFNCNLLYHDR++++P+LEKE GAKFEEDLD MLPKCD+VV+NTPLTEKTRGMF+K++IAKMKKGV+IVNNARGAIMDTQAV DACSSGHIAGY GDV
Sbjct:   47 NFVGCVEGALGIRDWLESKGHHYIVTDDKEGFNSELEKHIEDMHVLITTPFHPAYVTAEKIKKAKTPELLLTAGIGSDHIDLPAAAAAGLTVARVTGSNTVSVAEDELMRILILLRNFLPGYQQVVKGEWNVAGIAHRAYDLEGKTVGTVGAGRYGRLLLQRLKPFNCNLLYHDRLQINPELEKEIGAKFEEDLDAMLPKCDVVVINTPLTEKTRGMFNKEKIAKMKKGVIIVNNARGAIMDTQAVADACSSGHIAGYGGDV 308          

HSP 2 Score: 68.1662 bits (165), Expect = 2.786e-137
Identity = 29/33 (87.88%), Postives = 30/33 (90.91%), Query Frame = 2
Query:  818 KGHPWRYMPNQAMTPHVSGTTXDAQLRYAAGVK 916
            K HPWRYMPN AMTPH+SGTT DAQLRYAAGVK
Sbjct:  316 KDHPWRYMPNHAMTPHISGTTIDAQLRYAAGVK 348          
BLAST of EY756567 vs. ExPASy Swiss-Prot
Match: FDH_NEUCR (Formate dehydrogenase OS=Neurospora crassa GN=fdh PE=2 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 3.242e-83
Identity = 142/267 (53.18%), Postives = 189/267 (70.79%), Query Frame = 1
Query:    7 VRNFLGCVEGGCGLREWLESKGHLYLVTDDKEGPDCELEKHIPDLHVLISTPFHPAYVTAERIKKAKNLQLLLTAGVGSDHIDLNXXXXX--GLTVAEVTGSNVVSVAEDELMRILILVRNFLPGHHQVISGEWNVAGVAYRAYDLEGKTVGTVGCGRIGKLLLQRLKPFNC-NLLYHDRVKMDPQLEKETGAKFEEDLDTMLPKCDIVVVNTPLTEKTRGMFDKDRIAKMKKGVLIVNNARGAIMDTQAVVDACSSGHIAGYSGDV 798
            V   LG ++   GLR+WLE +GH  + T DK+G +   +K + D  ++I+TPFHP Y+TAER+ +AK L+L +TAG+GSDH+DLN       G+TVAEVTGSNVVSVAE  LM IL+LVRNF+P H Q+  G W+VA  A   +DLEGK VGTVG GRIG+ +L+RLKPF+C  LLY+D   +  + E E G +   DL+ ML +CD+V +N PL EKT+G+F+K+ I+KMKKG  +VN ARGAI+  + V +A  SGH+ GY GDV
Sbjct:   18 VPELLGTIQNELGLRKWLEDQGHTLVTTCDKDGENSTFDKELEDAEIIITTPFHPGYLTAERLARAKKLKLAVTAGIGSDHVDLNAANKTNGGITVAEVTGSNVVSVAEHVLMTILVLVRNFVPAHEQIQEGRWDVAEAAKNEFDLEGKVVGTVGVGRIGERVLRRLKPFDCKELLYYDYQPLSAEKEAEIGCRRVADLEEMLAQCDVVTINCPLHEKTQGLFNKELISKMKKGSWLVNTARGAIVVKEDVAEALKSGHLRGYGGDV 284          

HSP 2 Score: 41.9726 bits (97), Expect = 3.242e-83
Identity = 21/36 (58.33%), Postives = 23/36 (63.89%), Query Frame = 2
Query:  824 HPWRYMPN-----QAMTPHVSGTTXDAQLRYAAGVK 916
            HP RY  N      AM PH+SGT+ DAQ RYAAG K
Sbjct:  294 HPLRYAKNPFGGGNAMVPHMSGTSLDAQKRYAAGTK 329          
BLAST of EY756567 vs. ExPASy Swiss-Prot
Match: FDH_EMENI (Probable formate dehydrogenase OS=Emericella nidulans GN=aciA PE=2 SV=2)

HSP 1 Score: 285.419 bits (729), Expect = 2.969e-81
Identity = 144/280 (51.43%), Postives = 194/280 (69.29%), Query Frame = 1
Query:   19 LGCVEGGCGLREWLESKGHLYLVTDDKEGPDCELEKHIPDLHVLISTPFHPAYVTAERIKKAKNLQLLLTAGVGSDHIDLNXXXXX--GLTVAEVTGSNVVSVAEDELMRILILVRNFLPGHHQVISGEWNVAGVAYRAYDLEGKTVGTVGCGRIGKLLLQRLKPFNC-NLLYHDRVKMDPQLEKETGAKFEEDLDTMLPKCDIVVVNTPLTEKTRGMFDKDRIAKMK-----------------KGVLIVNNARGAIMDTQAVVDACSSGHIAGYSGDV 798
            LG  E   G+R+W+E +GH  + T DK+G +   +K + D  V+I+TPFHP Y+TAER+ KAKNL+L +TAG+GSDH+DL+       G+TVAEVTGSNVVSVAE  +M IL+LVRNF+P H Q+ +G+WNVA VA   +DLE K VGTVG GRIG+ +L+RLKPF+C  LLY+D   + P++EKE GA+  + L+ M+ +CD+V +N PL EKTRG+F+K+ I+KMK                 KG  +VN ARGAI+  + V +A  SGH+ GY GDV
Sbjct:   17 LGTTENELGIRKWIEEQGHTLVTTSDKDGENSTFDKELVDAEVIITTPFHPGYLTAERLAKAKNLKLAVTAGIGSDHVDLDAANKTNGGITVAEVTGSNVVSVAEHVVMTILLLVRNFVPAHDQIRNGDWNVAAVAKNEFDLENKVVGTVGVGRIGERVLRRLKPFDCKELLYYDYQPLRPEVEKEIGARRVDSLEEMVSQCDVVTINCPLHEKTRGLFNKELISKMKPGKSALLYLIIPMLMYHKGSWLVNTARGAIVVKEDVAEALKSGHLRGYGGDV 296          

HSP 2 Score: 38.1206 bits (87), Expect = 2.969e-81
Identity = 19/38 (50.00%), Postives = 23/38 (60.53%), Query Frame = 2
Query:  818 KGHPWRYMPN-----QAMTPHVSGTTXDAQLRYAAGVK 916
            K HP RY  +      A  PH+SGT+ DAQ+RYA G K
Sbjct:  304 KEHPLRYAEHPWGGGNATVPHMSGTSIDAQIRYANGTK 341          
BLAST of EY756567 vs. ExPASy Swiss-Prot
Match: FDH_PICAN (Formate dehydrogenase OS=Pichia angusta GN=FMDH PE=3 SV=2)

HSP 1 Score: 260.381 bits (664), Expect = 3.543e-76
Identity = 132/262 (50.38%), Postives = 178/262 (67.94%), Query Frame = 1
Query:   22 GCVEGGCGLREWLESKGHLYLVTDDKEGPDCELEKHIPDLHVLISTPFHPAYVTAERIKKAKNLQLLLTAGVGSDHIDLNXXXXXG--LTVAEVTGSNVVSVAEDELMRILILVRNFLPGHHQVISGEWNVAGVAYRAYDLEGKTVGTVGCGRIGKLLLQRLKPFN-CNLLYHDRVKMDPQLEKETGAKFEEDLDTMLPKCDIVVVNTPLTEKTRGMFDKDRIAKMKKGVLIVNNARGAIMDTQAVVDACSSGHIAGYSGDV 798
            GC E   G+R+WLE +GH  +VT DKEG +  LEK+I D  V+ISTPFHPAY+T ERI KAK L+LL+ AGVGSDHIDL+     G  ++V EVTGSNVVSVAE  +M +L+LVRNF+P H Q+ISG WNVA +A  ++D+EGK + T+G GRIG  +L+RL  FN   LLY+D   +  + E++ GA+   D+  ++ + DIV +N PL   ++G+ + + +   KKG  +VN ARGAI   + V  A  SG + GY GDV
Sbjct:   22 GCTENALGIRDWLEKQGHDVVVTSDKEGQNSVLEKNISDADVIISTPFHPAYITKERIDKAKKLKLLVVAGVGSDHIDLDYINQSGRDISVLEVTGSNVVSVAEHVVMTMLVLVRNFVPAHEQIISGGWNVAEIAKDSFDIEGKVIATIGAGRIGYRVLERLVAFNPKELLYYDYQSLSKEAEEKVGARRVHDIKELVAQADIVTINCPLHAGSKGLVNAELLKHFKKGAWLVNTARGAICVAEDVAAAVKSGQLRGYGGDV 283          

HSP 2 Score: 46.2098 bits (108), Expect = 3.543e-76
Identity = 22/38 (57.89%), Postives = 25/38 (65.79%), Query Frame = 2
Query:  818 KGHPWRYMPNQ-----AMTPHVSGTTXDAQLRYAAGVK 916
            K HPWR M N+     AMTPH SG+  DAQ+RYA G K
Sbjct:  291 KDHPWRSMANKYGAGNAMTPHYSGSVIDAQVRYAQGTK 328          
BLAST of EY756567 vs. ExPASy Swiss-Prot
Match: FDH_PSESR (Formate dehydrogenase OS=Pseudomonas sp. (strain 101) PE=1 SV=3)

HSP 1 Score: 249.595 bits (636), Expect = 6.576e-75
Identity = 129/260 (49.62%), Postives = 164/260 (63.08%), Query Frame = 1
Query:   19 LGCVEGGCGLREWLESKGHLYLVTDDKEGPDCELEKHIPDLHVLISTPFHPAYVTAERIKKAKNLQLLLTAGVGSDHIDLNXXXXXGLTVAEVTGSNVVSVAEDELMRILILVRNFLPGHHQVISGEWNVAGVAYRAYDLEGKTVGTVGCGRIGKLLLQRLKPFNCNLLYHDRVKMDPQLEKETGAKFEEDLDTMLPKCDIVVVNTPLTEKTRGMFDKDRIAKMKKGVLIVNNARGAIMDTQAVVDACSSGHIAGYSGDV 798
            LG V G  GLR++LES GH  +VT DK+GPD   E+ + D  V+IS PF PAY+T ERI KAKNL+L LTAG+GSDH+DL       +TVAEVT  N +SVAE  +M IL LVRN+LP H     G WN+A     AYDLE   VGTV  GRIG  +L+RL PF+ +L Y DR ++   +EKE    +    + M P CD+V +N PL  +T  M + + +   K+G  IVN ARG + D  AV  A  SG +AGY+GDV
Sbjct:   51 LGSVSGELGLRKYLESNGHTLVVTSDKDGPDSVFERELVDADVVISQPFWPAYLTPERIAKAKNLKLALTAGIGSDHVDLQSAIDRNVTVAEVTYCNSISVAEHVVMMILSLVRNYLPSHEWARKGGWNIADCVSHAYDLEAMHVGTVAAGRIGLAVLRRLAPFDVHLHYTDRHRLPESVEKELNLTWHATREDMYPVCDVVTLNCPLHPETEHMINDETLKLFKRGAYIVNTARGKLCDRDAVARALESGRLAGYAGDV 310          

HSP 2 Score: 52.7582 bits (125), Expect = 6.576e-75
Identity = 22/33 (66.67%), Postives = 24/33 (72.73%), Query Frame = 2
Query:  818 KGHPWRYMPNQAMTPHVSGTTXDAQLRYAAGVK 916
            K HPWR MP   MTPH+SGTT  AQ RYAAG +
Sbjct:  318 KDHPWRTMPYNGMTPHISGTTLTAQARYAAGTR 350          
BLAST of EY756567 vs. ExPASy Swiss-Prot
Match: FDH1_YEAST (Formate dehydrogenase 1 OS=Saccharomyces cerevisiae GN=FDH1 PE=2 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 2.248e-66
Identity = 122/274 (44.53%), Postives = 172/274 (62.77%), Query Frame = 1
Query:   19 LGCVEGGCGLREWLESKGHLYLVTDDKEG-PDCELEKHIPDLHVLISTPFHPAYVTAERIKKAKNLQLLLTAGVGSDHIDLNXXXXXGLTVAEVTGSNVVSVAEDELMRILILVRNFLPGHHQVISGEWNVAGVAYRAYDLEGKTVGTVGCGRIGKLLLQRLKPFN-CNLLYHDRVKMDPQL---EKETGAKFE---------EDLDTMLPKCDIVVVNTPLTEKTRGMFDKDRIAKMKKGVLIVNNARGAIMDTQAVVDACSSGHIAGYSGDV 798
            LGC+E   G+R ++E +G+  + T DK+  P   +++ + D  ++I+TPF PAY++  RI +A NL+L +TAGVGSDH+DL       +TV EVTGSNVVSVAE  +  IL+L+RN+  GH Q I+GEW++AGVA   YDLE K + TVG GRIG  +L+RL  FN   LLY+D  ++  +      E    F          E L+ M+ + D+V +N PL + +RG+F+K  I+ MK G  +VN ARGAI   + V +A  SG +AGY GDV
Sbjct:   24 LGCIENELGIRNFIEEQGYELVTTIDKDPEPTSTVDRELKDAEIVITTPFFPAYISRNRIAEAPNLKLCVTAGVGSDHVDLEAANERKITVTEVTGSNVVSVAEHVMATILVLIRNYNGGHQQAINGEWDIAGVAKNEYDLEDKIISTVGAGRIGYRVLERLVAFNPKKLLYYDYQELPAEAINRLNEASKLFNGRGDIVQRVEKLEDMVAQSDVVTINCPLHKDSRGLFNKKLISHMKDGAYLVNTARGAICVAEDVAEAVKSGKLAGYGGDV 297          

HSP 2 Score: 47.3654 bits (111), Expect = 2.248e-66
Identity = 23/46 (50.00%), Postives = 30/46 (65.22%), Query Frame = 2
Query:  794 MFESTTSSKGHPWRYMPNQ-----AMTPHVSGTTXDAQLRYAAGVK 916
            +++   + K HPWR M N+     AMT H+SGT+ DAQ RYA GVK
Sbjct:  297 VWDKQPAPKDHPWRTMDNKDHVGNAMTVHISGTSLDAQKRYAQGVK 342          
The following BLAST results are available for this feature:
BLAST of EY756567 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 231
Match NameE-valueIdentityDescription
FDH_SOLTU1.721e-14586.26Formate dehydrogenase, mitochondrial OS=Solanum tu... [more]
FDH1_ORYSJ1.236e-14082.44Formate dehydrogenase 1, mitochondrial OS=Oryza sa... [more]
FDH_ARATH1.357e-13982.06Formate dehydrogenase, mitochondrial OS=Arabidopsi... [more]
FDH2_ORYSJ5.137e-13980.53Formate dehydrogenase 2, mitochondrial OS=Oryza sa... [more]
FDH_HORVU2.786e-13780.53Formate dehydrogenase, mitochondrial OS=Hordeum vu... [more]
FDH_NEUCR3.242e-8353.18Formate dehydrogenase OS=Neurospora crassa GN=fdh ... [more]
FDH_EMENI2.969e-8151.43Probable formate dehydrogenase OS=Emericella nidul... [more]
FDH_PICAN3.543e-7650.38Formate dehydrogenase OS=Pichia angusta GN=FMDH PE... [more]
FDH_PSESR6.576e-7549.62Formate dehydrogenase OS=Pseudomonas sp. (strain 1... [more]
FDH1_YEAST2.248e-6644.53Formate dehydrogenase 1 OS=Saccharomyces cerevisia... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-010-A12-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756567 ID=EY756567|Name=EY756567|organism=Citrus sinensis|type=EST|length=916bp
CCACGCGTCCGCAACTTTCTTGGTTGTGTGGAGGGAGGCTGTGGTCTGCG
TGAATGGCTGGAATCGAAAGGTCACCTATATCTTGTCACTGATGACAAAG
AGGGACCAGACTGTGAACTAGAGAAACATATTCCTGATCTCCACGTCCTC
ATATCTACCCCCTTCCACCCTGCCTATGTTACGGCGGAAAGGATTAAGAA
GGCCAAAAATTTGCAACTGCTTCTCACTGCTGGAGTTGGCTCTGATCATA
TTGATCTAAATGCTGCTGCTGCTGCTGGTTTAACTGTTGCTGAAGTTACT
GGAAGCAATGTGGTTTCAGTTGCTGAGGACGAGCTTATGAGAATCCTTAT
TCTTGTCCGTAATTTCTTACCTGGACACCATCAAGTTATCAGTGGGGAAT
GGAATGTTGCCGGTGTTGCTTATAGAGCTTATGATCTTGAAGGAAAGACA
GTGGGAACTGTTGGTTGTGGACGCATTGGCAAGCTGTTGCTCCAACGACT
TAAACCTTTCAATTGTAATCTCCTTTATCATGACCGGGTGAAGATGGATC
CTCAATTGGAGAAAGAGACTGGAGCAAAATTTGAGGAGGATCTAGATACT
ATGCTTCCCAAATGTGACATAGTTGTTGTCAACACCCCTCTAACAGAAAA
GACGAGAGGGATGTTTGACAAAGATAGGATTGCAAAGATGAAGAAGGGCG
TCTTGATTGTCAACAATGCTCGAGGAGCAATCATGGACACACAAGCTGTT
GTTGACGCTTGCTCTAGTGGACACATTGCAGGTTATAGTGGTGATGTTTG
AATCCACAACCAGCTCCAAGGGACATCCCTGGCGTTACATGCCAAATCAG
GCAATGACCCCTCATGTTTCTGGGACCACTANTGATGCACAGCTACGCTA
TGCTGCGGGAGTCAAG
back to top