EY756516

Overview
NameEY756516
Unique NameEY756516
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length719
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13333 contig Csv1_Contig13333:1..719. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756516 vs. ExPASy Swiss-Prot
Match: TM167_DROME (Transmembrane protein 167 homolog OS=Drosophila melanogaster GN=CG14199 PE=3 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 9.665e-18
Identity = 39/70 (55.71%), Postives = 53/70 (75.71%), Query Frame = 2
Query:  233 SALFNFHSFLTVVLLGICTCTYIKMQFPAILE-HRTGFRGFFWKAARIGERLSPWVAVGCFSMGLSIIFF 439
            SALFNFHS L+V+LL ICTC Y++  FP++++ ++TGF G FWK ARIGER SPWV   C  M  +++F+
Sbjct:    4 SALFNFHSLLSVILLLICTCAYLRSLFPSLIDRNKTGFMGTFWKLARIGERKSPWVGAACLIMAFTVLFW 73          
BLAST of EY756516 vs. ExPASy Swiss-Prot
Match: T167A_DANRE (Transmembrane protein 167A OS=Danio rerio GN=tmem167a PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 8.182e-17
Identity = 42/70 (60.00%), Postives = 53/70 (75.71%), Query Frame = 2
Query:  230 MSALFNFHSFLTVVLLGICTCTYIKMQFPAILE-HRTGFRGFFWKAARIGERLSPWVAVGCFSMGLSIIF 436
            MSA+FNF S LTV+LL ICTC YI+   P++L+ ++TGF G FWK ARIGER SP+VA  C  M L+I+F
Sbjct:    1 MSAIFNFQSLLTVILLLICTCAYIRSLTPSLLDKNKTGFLGIFWKCARIGERKSPYVAFCCIVMALTILF 70          
BLAST of EY756516 vs. ExPASy Swiss-Prot
Match: T167A_MOUSE (Transmembrane protein 167A OS=Mus musculus GN=Tmem167a PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.069e-16
Identity = 42/70 (60.00%), Postives = 52/70 (74.29%), Query Frame = 2
Query:  230 MSALFNFHSFLTVVLLGICTCTYIKMQFPAILE-HRTGFRGFFWKAARIGERLSPWVAVGCFSMGLSIIF 436
            MSA+FNF S LTV+LL ICTC YI+   P+IL+ ++TG  G FWK ARIGER SP+VA+ C  M  SI+F
Sbjct:    1 MSAIFNFQSLLTVILLLICTCAYIRSLAPSILDRNKTGLLGIFWKCARIGERKSPYVAICCIVMAFSILF 70          
BLAST of EY756516 vs. ExPASy Swiss-Prot
Match: T167A_PONAB (Transmembrane protein 167A OS=Pongo abelii GN=TMEM167A PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.396e-16
Identity = 42/70 (60.00%), Postives = 52/70 (74.29%), Query Frame = 2
Query:  230 MSALFNFHSFLTVVLLGICTCTYIKMQFPAILE-HRTGFRGFFWKAARIGERLSPWVAVGCFSMGLSIIF 436
            MSA+FNF S LTV+LL ICTC YI+   P++L+ ++TG  G FWK ARIGER SP+VAV C  M  SI+F
Sbjct:    1 MSAIFNFQSLLTVILLLICTCAYIRSLAPSLLDRNKTGLLGIFWKCARIGERKSPYVAVCCIVMAFSILF 70          
BLAST of EY756516 vs. ExPASy Swiss-Prot
Match: T167A_HUMAN (Transmembrane protein 167A OS=Homo sapiens GN=TMEM167A PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.396e-16
Identity = 42/70 (60.00%), Postives = 52/70 (74.29%), Query Frame = 2
Query:  230 MSALFNFHSFLTVVLLGICTCTYIKMQFPAILE-HRTGFRGFFWKAARIGERLSPWVAVGCFSMGLSIIF 436
            MSA+FNF S LTV+LL ICTC YI+   P++L+ ++TG  G FWK ARIGER SP+VAV C  M  SI+F
Sbjct:    1 MSAIFNFQSLLTVILLLICTCAYIRSLAPSLLDRNKTGLLGIFWKCARIGERKSPYVAVCCIVMAFSILF 70          
BLAST of EY756516 vs. ExPASy Swiss-Prot
Match: T167A_BOVIN (Transmembrane protein 167A OS=Bos taurus GN=TMEM167A PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.396e-16
Identity = 42/70 (60.00%), Postives = 52/70 (74.29%), Query Frame = 2
Query:  230 MSALFNFHSFLTVVLLGICTCTYIKMQFPAILE-HRTGFRGFFWKAARIGERLSPWVAVGCFSMGLSIIF 436
            MSA+FNF S LTV+LL ICTC YI+   P++L+ ++TG  G FWK ARIGER SP+VAV C  M  SI+F
Sbjct:    1 MSAIFNFQSLLTVILLLICTCAYIRSLAPSLLDRNKTGLLGIFWKCARIGERKSPYVAVCCIVMAFSILF 70          
BLAST of EY756516 vs. ExPASy Swiss-Prot
Match: T167A_CHICK (Transmembrane protein 167A OS=Gallus gallus GN=TMEM167A PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.823e-16
Identity = 42/70 (60.00%), Postives = 52/70 (74.29%), Query Frame = 2
Query:  230 MSALFNFHSFLTVVLLGICTCTYIKMQFPAILE-HRTGFRGFFWKAARIGERLSPWVAVGCFSMGLSIIF 436
            MSA+FNF S LTV+LL ICTC YI+   P++L+ ++TG  G FWK ARIGER SP+VAV C  M  SI+F
Sbjct:    1 MSAIFNFQSLLTVILLLICTCAYIRSLAPSLLDKNKTGLLGIFWKCARIGERKSPYVAVCCVVMAFSILF 70          
BLAST of EY756516 vs. ExPASy Swiss-Prot
Match: T167A_TAEGU (Transmembrane protein 167A OS=Taeniopygia guttata GN=TMEM167A PE=3 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 5.303e-16
Identity = 41/70 (58.57%), Postives = 52/70 (74.29%), Query Frame = 2
Query:  230 MSALFNFHSFLTVVLLGICTCTYIKMQFPAILE-HRTGFRGFFWKAARIGERLSPWVAVGCFSMGLSIIF 436
            MSA+FNF S LTV+LL ICTC YI+   P++L+ +++G  G FWK ARIGER SP+VAV C  M  SI+F
Sbjct:    1 MSAIFNFQSLLTVILLLICTCAYIRSLAPSLLDKNKSGLLGIFWKCARIGERKSPYVAVCCVVMAFSILF 70          
BLAST of EY756516 vs. ExPASy Swiss-Prot
Match: T167A_XENTR (Transmembrane protein 167A OS=Xenopus tropicalis GN=tmem167a PE=3 SV=2)

HSP 1 Score: 82.4185 bits (202), Expect = 2.632e-15
Identity = 40/70 (57.14%), Postives = 50/70 (71.43%), Query Frame = 2
Query:  230 MSALFNFHSFLTVVLLGICTCTYIKMQFPAILE-HRTGFRGFFWKAARIGERLSPWVAVGCFSMGLSIIF 436
            MSA+FNF S L V+LL ICTC Y++   P +L+ ++TG  G FWK ARIGER SP+VAV C  M  SI+F
Sbjct:    1 MSAIFNFQSLLIVILLLICTCAYLRALVPNLLDKNKTGILGIFWKCARIGERKSPYVAVCCVVMAFSILF 70          
BLAST of EY756516 vs. ExPASy Swiss-Prot
Match: T167A_XENLA (Transmembrane protein 167A OS=Xenopus laevis GN=tmem167a PE=3 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 3.437e-15
Identity = 40/70 (57.14%), Postives = 50/70 (71.43%), Query Frame = 2
Query:  230 MSALFNFHSFLTVVLLGICTCTYIKMQFPAILE-HRTGFRGFFWKAARIGERLSPWVAVGCFSMGLSIIF 436
            MSA+FNF S L V+LL ICTC Y++   P +L+ ++TG  G FWK ARIGER SP+VAV C  M  SI+F
Sbjct:    1 MSAIFNFQSLLIVILLLICTCAYLRSLVPNLLDKNKTGVLGIFWKCARIGERKSPYVAVCCVVMAFSILF 70          
The following BLAST results are available for this feature:
BLAST of EY756516 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
TM167_DROME9.665e-1855.71Transmembrane protein 167 homolog OS=Drosophila me... [more]
T167A_DANRE8.182e-1760.00Transmembrane protein 167A OS=Danio rerio GN=tmem1... [more]
T167A_MOUSE1.069e-1660.00Transmembrane protein 167A OS=Mus musculus GN=Tmem... [more]
T167A_PONAB1.396e-1660.00Transmembrane protein 167A OS=Pongo abelii GN=TMEM... [more]
T167A_HUMAN1.396e-1660.00Transmembrane protein 167A OS=Homo sapiens GN=TMEM... [more]
T167A_BOVIN1.396e-1660.00Transmembrane protein 167A OS=Bos taurus GN=TMEM16... [more]
T167A_CHICK1.823e-1660.00Transmembrane protein 167A OS=Gallus gallus GN=TME... [more]
T167A_TAEGU5.303e-1658.57Transmembrane protein 167A OS=Taeniopygia guttata ... [more]
T167A_XENTR2.632e-1557.14Transmembrane protein 167A OS=Xenopus tropicalis G... [more]
T167A_XENLA3.437e-1557.14Transmembrane protein 167A OS=Xenopus laevis GN=tm... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-009-E05-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756516 ID=EY756516|Name=EY756516|organism=Citrus sinensis|type=EST|length=719bp
CCACGCGTCCGCGAAAAAGAAATATTAATCTCGCCGTTGGACATTCGGAG
AGCACTTTGGAATTCGTTATCATTCATTCTAAAACTCTACGGTATCCCAA
ATCTCGTCTTTGCTTCACTGTAGCTTCGATTGAGATGATTATAATTTTTT
TTTGGTTAAATATTCGTCAGTAATGTCTGTCATTTTATAGATCTGAAGGA
GAAGTAATCAAATTAAGGAGATCGCAGGCATGTCGGCACTCTTCAATTTC
CATTCCTTTCTGACGGTTGTCCTGTTGGGGATTTGTACGTGCACTTATAT
AAAGATGCAATTTCCAGCAATTCTTGAACATAGAACTGGGTTTCGTGGTT
TCTTCTGGAAAGCAGCTAGGATTGGTGAGCGTTTGAGCCCCTGGGTTGCT
GTTGGATGCTTTTCAATGGGGCTTTCAATAATCTTTTTCTAACAAAGAAA
CATCTTGTCTATTTAGAAGTAAGGTCCTTCTTCTTACCATTTCTGGTATT
TTATGTATATGTCAGCAAATGTGTACTTCCTTGAAATTCAATATTATTGA
ATCGTTTGTCTGATATACGAGTATTTGTCAGACACTATTTTGTGACTCAT
TTCTTGTTTTCTAGCCATAGTAGCATTCTTTAGAAACTTTGNTTACTGAT
GTGCAAAGTGTGTGCAAAGAGCCATCTGTTTTAGAATGTCTATACTATGA
GAAATGGTNCTTGGAGGTT
back to top