EY756472

Overview
NameEY756472
Unique NameEY756472
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length587
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4938 contig Csv1_Contig4938:272..858. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756472 vs. ExPASy Swiss-Prot
Match: GDL29_ARATH (GDSL esterase/lipase At1g71691 OS=Arabidopsis thaliana GN=At1g71691 PE=2 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 7.204e-49
Identity = 84/121 (69.42%), Postives = 104/121 (85.95%), Query Frame = 3
Query:   21 EVNQLVMPFNANVKTMINNLNANLPGARFTFIDIARMFEDLLTNYRSYGFSVIDRGCCGIGRNGGQITCLPFQTPCANREQYVFWDAFHPTEAVNIMFGRKAFYGDQSVVYPMNIQQLASL 383
            EVNQLV+PFN NVKTMI+NLN NLP A+F ++DIA MFED++ N  +YG + +D+GCCGIG+N GQITCLPF+TPC NR+QYVFWDAFHPTE VN++  +KAF GD++V YP+NIQQLASL
Sbjct:  263 EVNQLVLPFNTNVKTMISNLNQNLPDAKFIYLDIAHMFEDIVANQAAYGLTTMDKGCCGIGKNRGQITCLPFETPCPNRDQYVFWDAFHPTEKVNLIMAKKAFAGDRTVAYPINIQQLASL 383          
BLAST of EY756472 vs. ExPASy Swiss-Prot
Match: GDL28_ARATH (GDSL esterase/lipase At1g71250 OS=Arabidopsis thaliana GN=At1g71250 PE=2 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 2.658e-35
Identity = 65/120 (54.17%), Postives = 84/120 (70.00%), Query Frame = 3
Query:   24 VNQLVMPFNANVKTMINNLNANLPGARFTFIDIARMFEDLLTNYRSYGFSVIDRGCCGIGRNGGQITCLPFQTPCANREQYVFWDAFHPTEAVNIMFGRKAFYGDQSVVYPMNIQQLASL 383
            VNQ++  FN  +K++++ LN   PGA + + +      D+L N  +YGFSV+DR CCGIGRN GQITCLP QTPC NR QYVFWDAFHPT+  N +  R+AFYG  S  YP+N+QQ+  L
Sbjct:  254 VNQILGTFNQGLKSLVDQLNQRSPGAIYVYGNTYSAIGDILNNPAAYGFSVVDRACCGIGRNQGQITCLPLQTPCPNRNQYVFWDAFHPTQTANSILARRAFYGPPSDAYPVNVQQMTLL 373          
BLAST of EY756472 vs. ExPASy Swiss-Prot
Match: GDL17_ARATH (GDSL esterase/lipase At1g33811 OS=Arabidopsis thaliana GN=At1g33811 PE=2 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 7.237e-33
Identity = 61/122 (50.00%), Postives = 86/122 (70.49%), Query Frame = 3
Query:   21 EVNQLVMPFNANVKTMINNLN-ANLPGARFTFIDIARMFEDLLTNYRSYGFSVIDRGCCGIGRNGGQITCLPFQTPCANREQYVFWDAFHPTEAVNIMFGRKAFYGDQSVVYPMNIQQLASL 383
            ++N  ++ FN  VK +++ LN   L GA+F ++D  +   DL  N  +YGF V+D+GCCG+GRN GQITCLP QTPC +R +Y+FWDAFHPTE  NI+  +  FY  ++  YP+NIQ+LA+L
Sbjct:  250 KINNAIVVFNTQVKKLVDRLNKGQLKGAKFVYLDSYKSTYDLAVNGAAYGFEVVDKGCCGVGRNNGQITCLPLQTPCPDRTKYLFWDAFHPTETANILLAKSNFY-SRAYTYPINIQELANL 370          
BLAST of EY756472 vs. ExPASy Swiss-Prot
Match: GDL82_ARATH (GDSL esterase/lipase At5g45670 OS=Arabidopsis thaliana GN=At5g45670 PE=2 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 1.783e-31
Identity = 62/121 (51.24%), Postives = 85/121 (70.25%), Query Frame = 3
Query:   24 VNQLVMPFNANVKTMINNLNANLPGARFTFIDIARMFEDLLTNYRSYGFSVIDRGCCGIGRNGGQITCLPFQTPCANREQYVFWDAFHPTEAVNIMFGRKAFYGD-QSVVYPMNIQQLASL 383
            +N     FN+ + ++++  N N P A+FT+I+   +F+D++TN   YGF V + GCCG+GRN GQITCLP Q PC NR +YVFWDAFHP EA NI+ GR++F  +  S  +P +IQQLASL
Sbjct:  242 INSANRIFNSKLISIVDAFNQNTPDAKFTYINAYGIFQDIITNPARYGFRVTNAGCCGVGRNNGQITCLPGQAPCLNRNEYVFWDAFHPGEAANIVIGRRSFKREAASDAHPYDIQQLASL 362          
BLAST of EY756472 vs. ExPASy Swiss-Prot
Match: GDL65_ARATH (GDSL esterase/lipase At4g18970 OS=Arabidopsis thaliana GN=At4g18970 PE=2 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 3.041e-31
Identity = 59/121 (48.76%), Postives = 85/121 (70.25%), Query Frame = 3
Query:   24 VNQLVMPFNANVKTMINNLNANLPGARFTFIDIARMFEDLLTNYRSYGFSVIDRGCCGIGRNGGQITCLPFQTPCANREQYVFWDAFHPTEAVNIMFGRKAFYGDQ-SVVYPMNIQQLASL 383
            +N     FN+ + +++++ N N PGA+FT+I+   +F+D++ N   YGF V + GCCG+GRN GQITCLP Q PC NR++YVFWDAFHP EA N++ G ++F  +  S  +P +IQQLA L
Sbjct:  241 INSANRIFNSKLVSLVDHFNQNTPGAKFTYINAYGIFQDMVANPSRYGFRVTNAGCCGVGRNNGQITCLPGQAPCLNRDEYVFWDAFHPGEAANVVIGSRSFQRESASDAHPYDIQQLARL 361          
BLAST of EY756472 vs. ExPASy Swiss-Prot
Match: GDL15_ARATH (GDSL esterase/lipase At1g29670 OS=Arabidopsis thaliana GN=At1g29670 PE=2 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 9.782e-30
Identity = 58/121 (47.93%), Postives = 82/121 (67.77%), Query Frame = 3
Query:   24 VNQLVMPFNANVKTMINNLNANLPGARFTFIDIARMFEDLLTNYRSYGFSVIDRGCCGIGRNGGQITCLPFQTPCANREQYVFWDAFHPTEAVNIMFGRKAFYGDQ-SVVYPMNIQQLASL 383
            +N     FN  ++++++ LN N P A+F +I+   +F+D++TN   +GF V + GCCGIGRN GQITCLP Q PC +R  YVFWDAFHPTEA N++  R+++     S  YPM+I +LA L
Sbjct:  243 INSANQIFNNKLRSLVDQLNNNHPDAKFIYINAYGIFQDMITNPARFGFRVTNAGCCGIGRNAGQITCLPGQRPCRDRNAYVFWDAFHPTEAANVIIARRSYNAQSASDAYPMDISRLAQL 363          
BLAST of EY756472 vs. ExPASy Swiss-Prot
Match: GLIP7_ARATH (GDSL esterase/lipase 7 OS=Arabidopsis thaliana GN=GLIP7 PE=2 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 3.479e-27
Identity = 52/121 (42.98%), Postives = 74/121 (61.16%), Query Frame = 3
Query:   21 EVNQLVMPFNANVKTMINNLNANLPGARFTFIDIARMFEDLLTNYRSYGFSVIDRGCCGIGRNGGQITCLPFQTPCANREQYVFWDAFHPTEAVNIMFGRKAFYGDQSVVYPMNIQQLASL 383
            ++N +V  FN+ +K + N LN  LPG+ F + ++  +F D++ N   YG  V +  CCG GR GG +TCLP Q PC +R QYVFWDAFHPTE  N +     F    +  YP+++ +LA L
Sbjct:  244 KINNMVSMFNSRLKDLANTLNTTLPGSFFVYQNVFDLFHDMVVNPSRYGLVVSNEACCGNGRYGGALTCLPLQQPCLDRNQYVFWDAFHPTETANKIIAHNTFSKSANYSYPISVYELAKL 364          
BLAST of EY756472 vs. ExPASy Swiss-Prot
Match: GDL64_ARATH (GDSL esterase/lipase At4g16230 OS=Arabidopsis thaliana GN=At4g16230 PE=2 SV=2)

HSP 1 Score: 120.939 bits (302), Expect = 4.544e-27
Identity = 55/122 (45.08%), Postives = 79/122 (64.75%), Query Frame = 3
Query:   21 EVNQLVMPFNANVKTMINNLNANLPGARFTFIDIARMFEDLLTNYRSYGFSVIDRGCCG-IGRNGGQITCLPFQTPCANREQYVFWDAFHPTEAVNIMFGRKAFYGDQSVVYPMNIQQLASL 383
            E N++   +N  +KT++  LN NL G+RF + D+ R+ +D++ NY SYGF      CC  +G+ GG I C P    C +R +YVFWD +HPTEA NI+  R+   GD S +YP+NI+QLA+L
Sbjct:  243 EPNEVAQMYNLKLKTLVEELNKNLQGSRFVYGDVFRIVDDIIQNYSSYGFESEKIPCCSLVGKVGGLIPCGPPSKVCMDRSKYVFWDPYHPTEAANIIIARRLLSGDTSDIYPINIRQLANL 364          
BLAST of EY756472 vs. ExPASy Swiss-Prot
Match: GDL75_ARATH (GDSL esterase/lipase At5g08460 OS=Arabidopsis thaliana GN=At5g08460 PE=2 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 7.751e-27
Identity = 56/123 (45.53%), Postives = 82/123 (66.67%), Query Frame = 3
Query:   24 VNQLVMPFNANVKTMINNLNANLPGAR---FTFIDIARMFEDLLTNYRSYGFSVIDRGCCGIGRNGGQITCLPFQTPCANREQYVFWDAFHPTEAVNIMFGRKAFYGDQSVVYPMNIQQLASL 383
            VN++   FN  + ++++ LN++   A    F + +      D+LTN  +YGF V DRGCCG+GRN G+ITCLP   PCA R+++VFWDAFHPT+A N++   +AF G +S  YP+N+ QL+ L
Sbjct:  263 VNEMAELFNNRLVSLVDRLNSDNKTASEAIFVYGNTYGAAVDILTNPFNYGFEVTDRGCCGVGRNRGEITCLPLAVPCAFRDRHVFWDAFHPTQAFNLIIALRAFNGSKSDCYPINLSQLSRL 385          
BLAST of EY756472 vs. ExPASy Swiss-Prot
Match: GDL14_ARATH (GDSL esterase/lipase At1g29660 OS=Arabidopsis thaliana GN=At1g29660 PE=2 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 3.847e-26
Identity = 54/121 (44.63%), Postives = 78/121 (64.46%), Query Frame = 3
Query:   24 VNQLVMPFNANVKTMINNLNANLPGARFTFIDIARMFEDLLTNYRSYGFSVIDRGCCGIGRNGGQITCLPFQTPCANREQYVFWDAFHPTEAVNIMFGRKAFYGDQSV-VYPMNIQQLASL 383
            +N     FN  + +M+  LN     A FT+I+    F+D++ N  +YGF+  +  CCGIGRNGGQ+TCLP + PC NR++YVFWDAFHP+ A N    ++++   +S  VYP++I QLA L
Sbjct:  244 INSANRIFNNRLISMVQQLNNAHSDASFTYINAYGAFQDIIANPSAYGFTNTNTACCGIGRNGGQLTCLPGEPPCLNRDEYVFWDAFHPSAAANTAIAKRSYNAQRSSDVYPIDISQLAQL 364          
The following BLAST results are available for this feature:
BLAST of EY756472 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 33
Match NameE-valueIdentityDescription
GDL29_ARATH7.204e-4969.42GDSL esterase/lipase At1g71691 OS=Arabidopsis thal... [more]
GDL28_ARATH2.658e-3554.17GDSL esterase/lipase At1g71250 OS=Arabidopsis thal... [more]
GDL17_ARATH7.237e-3350.00GDSL esterase/lipase At1g33811 OS=Arabidopsis thal... [more]
GDL82_ARATH1.783e-3151.24GDSL esterase/lipase At5g45670 OS=Arabidopsis thal... [more]
GDL65_ARATH3.041e-3148.76GDSL esterase/lipase At4g18970 OS=Arabidopsis thal... [more]
GDL15_ARATH9.782e-3047.93GDSL esterase/lipase At1g29670 OS=Arabidopsis thal... [more]
GLIP7_ARATH3.479e-2742.98GDSL esterase/lipase 7 OS=Arabidopsis thaliana GN=... [more]
GDL64_ARATH4.544e-2745.08GDSL esterase/lipase At4g16230 OS=Arabidopsis thal... [more]
GDL75_ARATH7.751e-2745.53GDSL esterase/lipase At5g08460 OS=Arabidopsis thal... [more]
GDL14_ARATH3.847e-2644.63GDSL esterase/lipase At1g29660 OS=Arabidopsis thal... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-009-A03-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756472 ID=EY756472|Name=EY756472|organism=Citrus sinensis|type=EST|length=587bp
TTCGTCGACCCACGCGTCCGGAAGTGAATCAACTTGTTATGCCTTTTAAT
GCAAATGTGAAGACTATGATTAACAATCTTAATGCCAATCTTCCTGGTGC
AAGATTCACCTTCATTGACATTGCCCGCATGTTTGAAGATCTCCTCACCA
ATTATAGATCATACGGATTCAGTGTAATAGATCGAGGGTGCTGTGGCATT
GGACGAAACGGAGGCCAAATTACATGTCTTCCATTCCAAACACCATGTGC
AAATCGAGAACAATACGTTTTCTGGGATGCATTTCACCCAACAGAAGCTG
TGAACATTATGTTTGGAAGAAAAGCTTTCTATGGTGACCAGAGCGTTGTT
TATCCCATGAACATCCAGCAGCTTGCCAGTCTTTAAACTTAGAAATTAAA
TGGACATATATGTTATTGTAATGTTTCTTGCTTGCTTAATTGCTTTGCAT
AATTAGCCACCGGTGTCTCGTCTGTCCATGTGAGTTTTTACTTGTTTAAT
TTGCTTGTGGGAAGTTTATGTAATCGAAGAACAAGTTGTGATTGTGTTTT
ATTGTGTTGCTAGTGGTTCAGTAAAAAAAAAAAAAAA
back to top