EY756267

Overview
NameEY756267
Unique NameEY756267
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length859
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1491 contig Csv1_Contig1491:197..1055. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756267 vs. ExPASy Swiss-Prot
Match: DOF33_ARATH (Dof zinc finger protein DOF3.3 OS=Arabidopsis thaliana GN=DOF3.3 PE=1 SV=2)

HSP 1 Score: 171.014 bits (432), Expect = 7.588e-42
Identity = 78/105 (74.29%), Postives = 87/105 (82.86%), Query Frame = 1
Query:  310 LKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKNSASHYRHITVSEALQNVRTDVPNGVHHPALKTNGTVLTFGSDA 624
            LKKP KILPCPRC SM+TKFCYYNNYN+NQPRHFCK CQRYWTAGGTMRNVPVGAGRRKNK+S+SHYRHIT+SEAL+  R D       P L+ N  VL+FG +A
Sbjct:  103 LKKPTKILPCPRCKSMETKFCYYNNYNINQPRHFCKACQRYWTAGGTMRNVPVGAGRRKNKSSSSHYRHITISEALEAARLD-------PGLQANTRVLSFGLEA 200          
BLAST of EY756267 vs. ExPASy Swiss-Prot
Match: DOF52_ARATH (Dof zinc finger protein DOF5.2 OS=Arabidopsis thaliana GN=DOF5.2 PE=1 SV=2)

HSP 1 Score: 169.474 bits (428), Expect = 2.208e-41
Identity = 97/187 (51.87%), Postives = 112/187 (59.89%), Query Frame = 1
Query:   94 DSEKEMSVDKPVETKQEDEAPPENSEESTNPGSTSGISENPKALPVXXXXXXXXXXXXXXXXXXXXXXXXXXLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKNSASHY-RH--ITVSEALQNV-RTDV--PNGVHHPALKTNGTVLTFGSDAPLCD 636
            D   E   DK  E   E +     +E +    +TSGI+E  +                              LKKPDKILPCPRCNSM+TKFCYYNNYNVNQPRHFCK CQRYWTAGGTMRNVPVGAGRRKNK+ ASHY RH  IT +EA+Q V RTD+  PNG +         +LTFGSD+ LC+
Sbjct:   68 DGGGESETDKKEEKDSECQEESLRNESNDVTTTTSGITEKTETTKAAKTNEESGGTACSQEGK---------LKKPDKILPCPRCNSMETKFCYYNNYNVNQPRHFCKKCQRYWTAGGTMRNVPVGAGRRKNKSPASHYNRHVSITSAEAMQKVARTDLQHPNGAN---------LLTFGSDSVLCE 236          
BLAST of EY756267 vs. ExPASy Swiss-Prot
Match: DOF55_ARATH (Dof zinc finger protein DOF5.5 OS=Arabidopsis thaliana GN=DOF5.5 PE=1 SV=2)

HSP 1 Score: 148.673 bits (374), Expect = 4.033e-35
Identity = 69/103 (66.99%), Postives = 78/103 (75.73%), Query Frame = 1
Query:  310 LKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKNSA--SHYRHITVSEALQNVRTDVPNGVHHPALKTNGTVLTF 612
            LKKP KILPCPRCNSM+TKFCYYNNYNVNQPRHFCK CQRYWT+GGTMR+VP+GAGRRKNKN++  SHY H+T+SE                   TNG VL+F
Sbjct:   47 LKKPTKILPCPRCNSMETKFCYYNNYNVNQPRHFCKACQRYWTSGGTMRSVPIGAGRRKNKNNSPTSHYHHVTISE-------------------TNGPVLSF 130          
BLAST of EY756267 vs. ExPASy Swiss-Prot
Match: DOF1A_ARATH (Dof zinc finger protein DOF1.10 OS=Arabidopsis thaliana GN=DOF1.10 PE=2 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 4.173e-32
Identity = 63/105 (60.00%), Postives = 77/105 (73.33%), Query Frame = 1
Query:  310 LKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKN--SASHYRHITVSEALQNVRTDVPNGVHHPALKTNGTVLTFGS 618
            LKKPDK++PCPRC S +TKFCYYNNYNVNQPR+FC+NCQRYWTAGG+MRNVPVG+GRRKNK   S++HY  +T  +   N                +GT+L+FGS
Sbjct:  125 LKKPDKLIPCPRCESANTKFCYYNNYNVNQPRYFCRNCQRYWTAGGSMRNVPVGSGRRKNKGWPSSNHYLQVTSEDCDNN---------------NSGTILSFGS 214          
BLAST of EY756267 vs. ExPASy Swiss-Prot
Match: DOF13_ARATH (Dof zinc finger protein DOF1.3 OS=Arabidopsis thaliana GN=DOF1.3 PE=2 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 2.071e-31
Identity = 60/73 (82.19%), Postives = 64/73 (87.67%), Query Frame = 1
Query:  310 LKKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKN--SASHYRHIT 522
            LKKPDKILPCPRCNS DTKFCYYNNYNVNQPRHFC+ CQRYWTAGG+MR VPVG+GRRKNK   S+  Y HIT
Sbjct:   98 LKKPDKILPCPRCNSADTKFCYYNNYNVNQPRHFCRKCQRYWTAGGSMRIVPVGSGRRKNKGWVSSDQYLHIT 170          
BLAST of EY756267 vs. ExPASy Swiss-Prot
Match: DOF15_ARATH (Dof zinc finger protein DOF1.5 OS=Arabidopsis thaliana GN=DOF1.5 PE=1 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 1.641e-28
Identity = 51/60 (85.00%), Postives = 57/60 (95.00%), Query Frame = 1
Query:  313 KKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNK 492
            K+PDKI+PCPRC SM+TKFCY+NNYNVNQPRHFCK CQRYWTAGG +RNVPVGAGRRK+K
Sbjct:   56 KRPDKIIPCPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKSK 115          
BLAST of EY756267 vs. ExPASy Swiss-Prot
Match: DOF23_ARATH (Dof zinc finger protein DOF2.3 OS=Arabidopsis thaliana GN=DOF2.3 PE=2 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 5.279e-27
Identity = 49/60 (81.67%), Postives = 55/60 (91.67%), Query Frame = 1
Query:  313 KKPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNK 492
            K+PDKI+ CPRC SM+TKFCY+NNYNVNQPRHFCK C RYWTAGG +RNVPVGAGRRK+K
Sbjct:   52 KRPDKIIACPRCKSMETKFCYFNNYNVNQPRHFCKGCHRYWTAGGALRNVPVGAGRRKSK 111          
BLAST of EY756267 vs. ExPASy Swiss-Prot
Match: DOF18_ARATH (Dof zinc finger protein DOF1.8 OS=Arabidopsis thaliana GN=DOF1.8 PE=2 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 2.076e-23
Identity = 43/62 (69.35%), Postives = 56/62 (90.32%), Query Frame = 1
Query:  322 DKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKNSASH 507
            D+ L CPRCNS++TKFCYYNNY++ QPR+FCK+C+RYWTAGG++RN+PVG G RKNK S+S+
Sbjct:   46 DQALNCPRCNSLNTKFCYYNNYSLTQPRYFCKDCRRYWTAGGSLRNIPVGGGVRKNKRSSSN 107          
BLAST of EY756267 vs. ExPASy Swiss-Prot
Match: DOF25_ARATH (Dof zinc finger protein DOF2.5 OS=Arabidopsis thaliana GN=DOF2.5 PE=2 SV=3)

HSP 1 Score: 108.227 bits (269), Expect = 6.040e-23
Identity = 49/93 (52.69%), Postives = 67/93 (72.04%), Query Frame = 1
Query:  316 KPDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKNSASHYRHITVSEALQNVRTDVPNGVHHPALKTN 594
            +P + L CPRCNS +TKFCYYNNY++ QPR+FCK C+RYWT GG++RNVPVG   RKNK S+S     + S  LQ + + +P+ ++ P L +N
Sbjct:   75 RPQEKLNCPRCNSTNTKFCYYNNYSLTQPRYFCKGCRRYWTEGGSLRNVPVGGSSRKNKRSSSS----SSSNILQTIPSSLPD-LNPPILFSN 162          
BLAST of EY756267 vs. ExPASy Swiss-Prot
Match: MNB1A_MAIZE (Dof zinc finger protein MNB1A OS=Zea mays GN=MNB1A PE=1 SV=2)

HSP 1 Score: 107.071 bits (266), Expect = 1.346e-22
Identity = 43/57 (75.44%), Postives = 48/57 (84.21%), Query Frame = 1
Query:  334 PCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKNSAS 504
            PCPRC S DTKFCYYNNYN +QPRHFCK C+RYWT GGT+RNVPVG G RK  +S+S
Sbjct:   48 PCPRCASRDTKFCYYNNYNTSQPRHFCKGCRRYWTKGGTLRNVPVGGGTRKKPSSSS 104          
The following BLAST results are available for this feature:
BLAST of EY756267 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 38
Match NameE-valueIdentityDescription
DOF33_ARATH7.588e-4274.29Dof zinc finger protein DOF3.3 OS=Arabidopsis thal... [more]
DOF52_ARATH2.208e-4151.87Dof zinc finger protein DOF5.2 OS=Arabidopsis thal... [more]
DOF55_ARATH4.033e-3566.99Dof zinc finger protein DOF5.5 OS=Arabidopsis thal... [more]
DOF1A_ARATH4.173e-3260.00Dof zinc finger protein DOF1.10 OS=Arabidopsis tha... [more]
DOF13_ARATH2.071e-3182.19Dof zinc finger protein DOF1.3 OS=Arabidopsis thal... [more]
DOF15_ARATH1.641e-2885.00Dof zinc finger protein DOF1.5 OS=Arabidopsis thal... [more]
DOF23_ARATH5.279e-2781.67Dof zinc finger protein DOF2.3 OS=Arabidopsis thal... [more]
DOF18_ARATH2.076e-2369.35Dof zinc finger protein DOF1.8 OS=Arabidopsis thal... [more]
DOF25_ARATH6.040e-2352.69Dof zinc finger protein DOF2.5 OS=Arabidopsis thal... [more]
MNB1A_MAIZE1.346e-2275.44Dof zinc finger protein MNB1A OS=Zea mays GN=MNB1A... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-006-E07-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756267 ID=EY756267|Name=EY756267|organism=Citrus sinensis|type=EST|length=859bp
CCACGCGTCCGTGATGATAGAATCGATCAGGATCCAACTTGTTCAACAAA
TTCTTCACGAGAAAGCGATAAGAGCAGAGACGGAGAAGAAAGAGACTCTG
AGAAGGAGATGTCGGTAGACAAGCCTGTTGAGACCAAACAGGAAGATGAA
GCCCCACCAGAAAATTCTGAAGAGTCCACAAATCCAGGTTCAACCTCGGG
GATCAGTGAGAACCCTAAAGCATTGCCTGTTGAAAAGGAGTGCACTACAG
TGAAGACTTCAAAGACAGAAGAAGAGCAGAGCGAACCTAGTACTTCACAA
GAAAAGACCTTGAAGAAACCTGACAAGATTCTTCCATGCCCACGTTGTAA
TAGTATGGACACTAAGTTCTGCTACTACAACAATTACAATGTAAACCAAC
CACGACACTTCTGCAAGAACTGCCAGAGATACTGGACAGCTGGTGGGACA
ATGCGTAATGTACCTGTAGGTGCTGGTCGTCGAAAGAACAAGAACTCAGC
TTCTCACTACCGTCACATAACTGTCTCGGAAGCCCTCCAAAACGTCCGAA
CTGATGTTCCGAATGGGGTCCACCATCCTGCGTTGAAAACTAATGGTACT
GTACTTACTTTTGGCTCAGATGCACCCCTTTGTGATCAATGGCATCAGTT
CTGAATATTGCTGATAAAACAATGAGGGATTGCACNGAGAATGGGTTTCA
TAAACCTGAGGGAGTGAGATTCGACTTACTTACAGAGGTGGAGAAAATGG
GGATATTATGCACATGGATCTCCGGGCCAGTTTCAATTTCAAAGATGAAG
CAGGCAAACTACTTCCCAGGAGGCAGTGTGCAAAATTGCAGGCTTCCCTC
TCATGTGCT
back to top