EY756263

Overview
NameEY756263
Unique NameEY756263
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length926
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY756263 vs. ExPASy Swiss-Prot
Match: CTR1_HUMAN (High affinity cationic amino acid transporter 1 OS=Homo sapiens GN=SLC7A1 PE=1 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 1.960e-15
Identity = 40/120 (33.33%), Postives = 57/120 (47.50%), Query Frame = 3
Query:  312 FLIAGIASAFSAFCYAELASRWPSAGSAYHYSYICVGEGVRWLIG*L*YLSTQLAGLLFLVAYTRIWLC---------ILPFFLAHQEIPGLDIIV---DPCAAIIVLFGTGLLCVGIKE 635
            FLIA +AS  +  CY E  +R P  GSAY YSY+ VGE   ++ G     +  L+ ++   +  R W           I  F   H  +    ++    D  A II+L  TGLL +G+KE
Sbjct:   70 FLIAALASVLAGLCYGEFGARVPKTGSAYLYSYVTVGELWAFITG----WNLILSYIIGTSSVARAWSATFDELIGRPIGEFSRTHMTLNAPGVLAENPDIFAVIIILILTGLLTLGVKE 185          

HSP 2 Score: 46.595 bits (109), Expect = 1.960e-15
Identity = 20/30 (66.67%), Postives = 25/30 (83.33%), Query Frame = 2
Query:  224 GVDSTLGAGAYILVGTVAREHSGPALTLSF 313
            GV STLGAG Y+L G VARE++GPA+ +SF
Sbjct:   41 GVGSTLGAGVYVLAGAVARENAGPAIVISF 70          
BLAST of EY756263 vs. ExPASy Swiss-Prot
Match: CTR1_RAT (High affinity cationic amino acid transporter 1 OS=Rattus norvegicus GN=Slc7a1 PE=2 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 4.301e-15
Identity = 39/120 (32.50%), Postives = 57/120 (47.50%), Query Frame = 3
Query:  312 FLIAGIASAFSAFCYAELASRWPSAGSAYHYSYICVGEGVRWLIG*L*YLSTQLAGLLFLVAYTRIWLC---------ILPFFLAHQEIPGLDIIV---DPCAAIIVLFGTGLLCVGIKE 635
            FLIA +AS  +  CY E  +R P  GSAY YSY+ VGE   ++ G     +  L+ ++   +  R W           I  F   H  +    ++    D  A II++  TGLL +G+KE
Sbjct:   70 FLIAALASVLAGLCYGEFGARVPKTGSAYLYSYVTVGELWAFITG----WNLILSYIIGTSSVARAWSATFDELIGKPIGEFSRQHMALNAPGVLAQTPDIFAVIIIIILTGLLTLGVKE 185          

HSP 2 Score: 46.595 bits (109), Expect = 4.301e-15
Identity = 20/30 (66.67%), Postives = 25/30 (83.33%), Query Frame = 2
Query:  224 GVDSTLGAGAYILVGTVAREHSGPALTLSF 313
            GV STLGAG Y+L G VARE++GPA+ +SF
Sbjct:   41 GVGSTLGAGVYVLAGAVARENAGPAIVISF 70          
BLAST of EY756263 vs. ExPASy Swiss-Prot
Match: CTR1_MOUSE (High affinity cationic amino acid transporter 1 OS=Mus musculus GN=Slc7a1 PE=2 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 4.301e-15
Identity = 39/120 (32.50%), Postives = 57/120 (47.50%), Query Frame = 3
Query:  312 FLIAGIASAFSAFCYAELASRWPSAGSAYHYSYICVGEGVRWLIG*L*YLSTQLAGLLFLVAYTRIWLC---------ILPFFLAHQEIPGLDIIV---DPCAAIIVLFGTGLLCVGIKE 635
            FLIA +AS  +  CY E  +R P  GSAY YSY+ VGE   ++ G     +  L+ ++   +  R W           I  F   H  +    ++    D  A II++  TGLL +G+KE
Sbjct:   70 FLIAALASVLAGLCYGEFGARVPKTGSAYLYSYVTVGELWAFITG----WNLILSYIIGTSSVARAWSATFDELIGKPIGEFSRQHMALNAPGVLAQTPDIFAVIIIIILTGLLTLGVKE 185          

HSP 2 Score: 46.595 bits (109), Expect = 4.301e-15
Identity = 20/30 (66.67%), Postives = 25/30 (83.33%), Query Frame = 2
Query:  224 GVDSTLGAGAYILVGTVAREHSGPALTLSF 313
            GV STLGAG Y+L G VARE++GPA+ +SF
Sbjct:   41 GVGSTLGAGVYVLAGAVARENAGPAIVISF 70          
BLAST of EY756263 vs. ExPASy Swiss-Prot
Match: CTR2_XENLA (Low affinity cationic amino acid transporter 2 OS=Xenopus laevis GN=slc7a2 PE=2 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 2.069e-14
Identity = 38/119 (31.93%), Postives = 56/119 (47.06%), Query Frame = 3
Query:  312 FLIAGIASAFSAFCYAELASRWPSAGSAYHYSYICVGEGVRWLIG*L*YLSTQLAGLLFLVAYTRIWLCILPFFLA-----------HQEIPGLDIIVDPCAAIIVLFGTGLLCVGIKE 635
            FLIA +AS  +  CYAE  +R P  GSAY YSY+ VGE   ++ G     +  L+ ++   +  R W       +            H ++PGL    D  A  +++   GLL  G+KE
Sbjct:   72 FLIAALASVLAGLCYAEFGARVPLTGSAYLYSYVTVGELWAFITG----WNLILSYVIGTSSVARAWSATFDELVGKKIGNFLGNTMHMDLPGLAEYPDIFAVCLIILLAGLLSFGVKE 186          

HSP 2 Score: 41.2022 bits (95), Expect = 2.069e-14
Identity = 18/30 (60.00%), Postives = 23/30 (76.67%), Query Frame = 2
Query:  224 GVDSTLGAGAYILVGTVAREHSGPALTLSF 313
            GV STLGAG Y+L G VA+  SGP++ +SF
Sbjct:   43 GVGSTLGAGVYVLAGEVAKVDSGPSIIISF 72          
BLAST of EY756263 vs. ExPASy Swiss-Prot
Match: CTR2_CHICK (Low affinity cationic amino acid transporter 2 OS=Gallus gallus GN=SLC7A2 PE=2 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 4.531e-14
Identity = 39/115 (33.91%), Postives = 57/115 (49.57%), Query Frame = 3
Query:  312 FLIAGIASAFSAFCYAELASRWPSAGSAYHYSYICVGEGVRWLIG*L*YLSTQLAGLLFLVAYTRIWLCILPFFLAH-------QEIPGLDIIVDPCAAIIVLFGTGLLCVGIKE 635
            FLIA +AS  +  CYAE  +R P  GSAY Y+Y+ VGE   ++ G    LS  +       A++  +  +L   ++H          PGL    D  A  ++L  +GLL  G+KE
Sbjct:   71 FLIAALASVMAGLCYAEFGARVPKTGSAYLYTYVAVGELWAFITGWNLILSYVIGTSSVARAWSGTFDELLGKQISHFFKTYFKMNYPGLAEYPDFFAVFLILLLSGLLSFGVKE 185          

HSP 2 Score: 41.9726 bits (97), Expect = 4.531e-14
Identity = 18/30 (60.00%), Postives = 23/30 (76.67%), Query Frame = 2
Query:  224 GVDSTLGAGAYILVGTVAREHSGPALTLSF 313
            GV STLGAG Y+L G VA+  SGP++ +SF
Sbjct:   42 GVGSTLGAGVYVLAGEVAKSDSGPSIVVSF 71          
BLAST of EY756263 vs. ExPASy Swiss-Prot
Match: CTR2_DANRE (Low affinity cationic amino acid transporter 2 OS=Danio rerio GN=slc7a2 PE=2 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 9.938e-14
Identity = 40/122 (32.79%), Postives = 59/122 (48.36%), Query Frame = 3
Query:  312 FLIAGIASAFSAFCYAELASRWPSAGSAYHYSYICVGEGVRWLIG*L*YLSTQLAGLLFLVAYTRIW--------------LCILPFFLAHQEIPGLDIIVDPCAAIIVLFGTGLLCVGIKE 635
            FLIA +AS  +  CYAE  +R P  GSAY YSY+ VGE   ++ G     +  L+ ++   +  R W               C + F ++   +PGL    D  A  ++L  +GLL  G+KE
Sbjct:   70 FLIAALASVMAGLCYAEFGARVPKTGSAYLYSYVTVGELWAFITG----WNLILSYVIGTSSVARAWSGTFDEIIGGHIEKFCKMYFKMS---LPGLAEYPDFFAVCLILLLSGLLSFGVKE 184          

HSP 2 Score: 41.2022 bits (95), Expect = 9.938e-14
Identity = 18/30 (60.00%), Postives = 23/30 (76.67%), Query Frame = 2
Query:  224 GVDSTLGAGAYILVGTVAREHSGPALTLSF 313
            GV STLGAG Y+L G VA+  SGP++ +SF
Sbjct:   41 GVGSTLGAGVYVLAGEVAKGSSGPSIVVSF 70          
BLAST of EY756263 vs. ExPASy Swiss-Prot
Match: YFNA_BACSU (Uncharacterized amino acid permease yfnA OS=Bacillus subtilis GN=yfnA PE=3 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 4.813e-13
Identity = 43/140 (30.71%), Postives = 76/140 (54.29%), Query Frame = 3
Query:  312 FLIAGIASAFSAFCYAELASRWPSAGSAYHYSYICVGEGVRWLIG*L*YLSTQLAGLLFLVAYTRIWLCILPFFLAH-----QEIPG--LDIIVDPCAAIIVLFGTGLLCVGIKEFYPHFSHQLIMYHCNLVRVLWLLVG 710
            F++AG+A A +AFCYAE +S  P +GS Y YSY+ +GE + +LIG    L   +A       ++  +  +L  F  H        PG     + +  AA+I+L  T ++  G+KE    F++ +++    ++ +L+++VG
Sbjct:   64 FILAGLACALAAFCYAEFSSSIPISGSVYSYSYVTLGELLAFLIGWDLMLEYVIALSAVATGWSSYFQSLLAGFNLHIPAALTGAPGSMAGAVFNLPAAVIILLITAIVSRGVKE-STRFNNVIVLMKIAII-LLFIIVG 201          

HSP 2 Score: 33.8834 bits (76), Expect = 4.813e-13
Identity = 13/30 (43.33%), Postives = 20/30 (66.67%), Query Frame = 2
Query:  224 GVDSTLGAGAYILVGTVAREHSGPALTLSF 313
            G+   +G G +++ GTVA   +GPAL +SF
Sbjct:   35 GIGCVIGTGIFVITGTVAATGAGPALIISF 64          
BLAST of EY756263 vs. ExPASy Swiss-Prot
Match: CTR2_PIG (Low affinity cationic amino acid transporter 2 OS=Sus scrofa GN=SLC7A2 PE=2 SV=1)

HSP 1 Score: 53.1434 bits (126), Expect = 6.192e-13
Identity = 39/119 (32.77%), Postives = 54/119 (45.38%), Query Frame = 3
Query:  312 FLIAGIASAFSAFCYAELASRWPSAGSAYHYSYICVGEGVRWLIG*L*YLSTQLAGLLFLVAYTRIWLCILPFFLAHQ-----------EIPGLDIIVDPCAAIIVLFGTGLLCVGIKE 635
            FLIA +AS  +  CYAE  +R P  GSAY Y+Y+ VGE   ++ G     +  L+ ++   +  R W   L   L  Q              GL    D  A  ++L   GLL  G+KE
Sbjct:   72 FLIAALASVMAGLCYAEFGARVPKTGSAYLYTYVTVGELWAFITG----WNLILSYVIGTSSVARAWSGTLDELLNKQIGQFFRTYFKMNYTGLAEYPDFSAVCLILLLAGLLSFGVKE 186          

HSP 2 Score: 41.5874 bits (96), Expect = 6.192e-13
Identity = 18/30 (60.00%), Postives = 23/30 (76.67%), Query Frame = 2
Query:  224 GVDSTLGAGAYILVGTVAREHSGPALTLSF 313
            GV STLGAG Y+L G VA+  SGP++ +SF
Sbjct:   43 GVGSTLGAGVYVLAGEVAKADSGPSIVVSF 72          
BLAST of EY756263 vs. ExPASy Swiss-Prot
Match: CTR2_HUMAN (Low affinity cationic amino acid transporter 2 OS=Homo sapiens GN=SLC7A2 PE=1 SV=2)

HSP 1 Score: 52.373 bits (124), Expect = 1.044e-12
Identity = 38/119 (31.93%), Postives = 54/119 (45.38%), Query Frame = 3
Query:  312 FLIAGIASAFSAFCYAELASRWPSAGSAYHYSYICVGEGVRWLIG*L*YLSTQLAGLLFLVAYTRIWLCILPFFLAHQ-----------EIPGLDIIVDPCAAIIVLFGTGLLCVGIKE 635
            FLIA +AS  +  CYAE  +R P  GSAY Y+Y+ VGE   ++ G     +  L+ ++   +  R W       L+ Q              GL    D  A  ++L   GLL  G+KE
Sbjct:   72 FLIAALASVMAGLCYAEFGARVPKTGSAYLYTYVTVGELWAFITG----WNLILSYVIGTSSVARAWSGTFDELLSKQIGQFLRTYFRMNYTGLAEYPDFFAVCLILLLAGLLSFGVKE 186          

HSP 2 Score: 41.5874 bits (96), Expect = 1.044e-12
Identity = 18/30 (60.00%), Postives = 23/30 (76.67%), Query Frame = 2
Query:  224 GVDSTLGAGAYILVGTVAREHSGPALTLSF 313
            GV STLGAG Y+L G VA+  SGP++ +SF
Sbjct:   43 GVGSTLGAGVYVLAGEVAKADSGPSIVVSF 72          
BLAST of EY756263 vs. ExPASy Swiss-Prot
Match: CTR2_RAT (Low affinity cationic amino acid transporter 2 OS=Rattus norvegicus GN=Slc7a2 PE=2 SV=1)

HSP 1 Score: 51.6026 bits (122), Expect = 1.761e-12
Identity = 40/115 (34.78%), Postives = 55/115 (47.83%), Query Frame = 3
Query:  312 FLIAGIASAFSAFCYAELASRWPSAGSAYHYSYICVGEGVRWLIG*L*YLSTQLAGLLFLVAYTRIWLCIL-----PFFLAH--QEIPGLDIIVDPCAAIIVLFGTGLLCVGIKE 635
            FLIA +AS  +  CYAE  +R P  GSAY Y+Y+ VGE   ++ G    LS  +       A++  +  +L      FF  +      GL    D  A  +VL   GLL  G+KE
Sbjct:   72 FLIAALASVMAGLCYAEFGARVPKTGSAYLYTYVTVGELWAFITGWNLILSYVIGTSSVARAWSGTFDELLNKQIGQFFKTYFKMNYTGLAEYPDFFAVCLVLLLAGLLSFGVKE 186          

HSP 2 Score: 41.5874 bits (96), Expect = 1.761e-12
Identity = 18/30 (60.00%), Postives = 23/30 (76.67%), Query Frame = 2
Query:  224 GVDSTLGAGAYILVGTVAREHSGPALTLSF 313
            GV STLGAG Y+L G VA+  SGP++ +SF
Sbjct:   43 GVGSTLGAGVYVLAGEVAKADSGPSIVVSF 72          
The following BLAST results are available for this feature:
BLAST of EY756263 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 15
Match NameE-valueIdentityDescription
CTR1_HUMAN1.960e-1533.33High affinity cationic amino acid transporter 1 OS... [more]
CTR1_RAT4.301e-1532.50High affinity cationic amino acid transporter 1 OS... [more]
CTR1_MOUSE4.301e-1532.50High affinity cationic amino acid transporter 1 OS... [more]
CTR2_XENLA2.069e-1431.93Low affinity cationic amino acid transporter 2 OS=... [more]
CTR2_CHICK4.531e-1433.91Low affinity cationic amino acid transporter 2 OS=... [more]
CTR2_DANRE9.938e-1432.79Low affinity cationic amino acid transporter 2 OS=... [more]
YFNA_BACSU4.813e-1330.71Uncharacterized amino acid permease yfnA OS=Bacill... [more]
CTR2_PIG6.192e-1332.77Low affinity cationic amino acid transporter 2 OS=... [more]
CTR2_HUMAN1.044e-1231.93Low affinity cationic amino acid transporter 2 OS=... [more]
CTR2_RAT1.761e-1234.78Low affinity cationic amino acid transporter 2 OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-006-E02-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756263 ID=EY756263|Name=EY756263|organism=Citrus sinensis|type=EST|length=926bp
CCACGCGTCCGATCTATGTTCAAGCCCTAATTTTTTCATTCTCAAAATTG
GCCTATCTATGTTCAAGCCCTAATTTTTTCATTCTCAAATTTGATATCTC
TAATTTTTTCATTCTCAAATTTGATATCTCTCTTCAGGCCCTACATTGCT
CAGTGGGAGGCATGAATCAGAATGAATAAAGCCGTACATTAGCTCGCTGG
GGAGCAACGCCGAATGAATAAAAGGTGTTGACTCAACACTTGGGGCTGGA
GCATATATTCTTGTTGGAACAGTTGCTAGAGAGCATTCAGGACCGGCACT
CACCCTTTCGTTTCCTTATAGCTGGAATAGCTTCTGCTTTTTCAGCCTTT
TGCTATGCTGAGCTTGCAAGTCGTTGGCCATCTGCTGGGAGTGCCTATCA
TTATTCATACATATGTGTTGGAGAAGGTGTTAGGTGGTTGATTGGCTAGC
TCTGATACTTGAGTACACAATTGGCGGGTCTGCTGTTCCTCGTGGCATAT
ACCCGAATCTGGTTGTGCATTCTTCCTTTCTTTTTGGCTCATCAAGAAAT
TCCTGGGCTTGACATTATTGTTGATCCCTGTGCTGCAATTATTGTACTTT
TTGGTACTGGACTCTTGTGTGTGGGAATCAAGGAGTTCTATCCACACTTC
AGTCATCAATTGATTATGTATCATTGCAATTTAGTCAGAGTTCTCTGGCT
ATTAGTGGGCAAAACCTTGNTGATGNTGGCACTTTGAAATAACTCAGCCT
TGGCCAAAAGGGTGGNAGCAGCAAGTATCCTTTTATTAAACGAGNTCAAG
GGGAGAATTCACCCGGATATGCTTGGNTCTATAAATATCTGGCATAGTGT
TTACTGAAAACTTTTGATGTGCCCAACCTCTTGGTACGAAACGAATGAAA
TGNATTAGTTGGACTCAATTGACAAG
back to top