EY756257

Overview
NameEY756257
Unique NameEY756257
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length690
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY756257_ssr661 microsatellite EY756257_ssr661:661..675. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig13118 contig Csv1_Contig13118:454..1143. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756257 vs. ExPASy Swiss-Prot
Match: APC10_ARATH (Anaphase-promoting complex subunit 10 OS=Arabidopsis thaliana GN=At2g18290 PE=2 SV=2)

HSP 1 Score: 165.236 bits (417), Expect = 2.877e-40
Identity = 75/88 (85.23%), Postives = 82/88 (93.18%), Query Frame = 3
Query:   12 DGFHNLKEIKTVELVKPTGWVYISLSGNDPRDTFVNTFMLQIVVLSNHLNGRDTHVRQIKIYGPRPNPIPHQQFQFTSSEFNTYSTVR 275
            DGFHNLKEIK+VELVKPTGWV +SLSG DPR+TFVNTFMLQI +LSNHLNGRDTH+RQIK+YGPRPNPIPHQ FQFTS EF TYST+R
Sbjct:  105 DGFHNLKEIKSVELVKPTGWVCLSLSGTDPRETFVNTFMLQIAILSNHLNGRDTHIRQIKVYGPRPNPIPHQPFQFTSMEFLTYSTLR 192          
BLAST of EY756257 vs. ExPASy Swiss-Prot
Match: APC10_MOUSE (Anaphase-promoting complex subunit 10 OS=Mus musculus GN=Anapc10 PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 3.784e-16
Identity = 41/88 (46.59%), Postives = 61/88 (69.32%), Query Frame = 3
Query:   12 DGFHNLKEIKTVELVKPTGWVYISLSGNDPRDTFVNTFMLQIVVLSNHLNGRDTHVRQIKIYGPRPNPIPHQQFQFTSSEFNTYSTVR 275
            + FHNL+EI+ +ELV+P+GW+++ L+ N  + T   TFM+QI VL+NH NGRDTH+RQIKIY P       +  + T+ +F  Y ++R
Sbjct:  100 NNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPT--RTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR 185          
BLAST of EY756257 vs. ExPASy Swiss-Prot
Match: APC10_HUMAN (Anaphase-promoting complex subunit 10 OS=Homo sapiens GN=ANAPC10 PE=1 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 3.784e-16
Identity = 41/88 (46.59%), Postives = 61/88 (69.32%), Query Frame = 3
Query:   12 DGFHNLKEIKTVELVKPTGWVYISLSGNDPRDTFVNTFMLQIVVLSNHLNGRDTHVRQIKIYGPRPNPIPHQQFQFTSSEFNTYSTVR 275
            + FHNL+EI+ +ELV+P+GW+++ L+ N  + T   TFM+QI VL+NH NGRDTH+RQIKIY P       +  + T+ +F  Y ++R
Sbjct:  100 NNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPT--RTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR 185          
BLAST of EY756257 vs. ExPASy Swiss-Prot
Match: APC10_BOVIN (Anaphase-promoting complex subunit 10 OS=Bos taurus GN=ANAPC10 PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 3.784e-16
Identity = 41/88 (46.59%), Postives = 61/88 (69.32%), Query Frame = 3
Query:   12 DGFHNLKEIKTVELVKPTGWVYISLSGNDPRDTFVNTFMLQIVVLSNHLNGRDTHVRQIKIYGPRPNPIPHQQFQFTSSEFNTYSTVR 275
            + FHNL+EI+ +ELV+P+GW+++ L+ N  + T   TFM+QI VL+NH NGRDTH+RQIKIY P       +  + T+ +F  Y ++R
Sbjct:  100 NNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPT--RTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR 185          
BLAST of EY756257 vs. ExPASy Swiss-Prot
Match: APC10_DROME (Anaphase-promoting complex subunit 10 OS=Drosophila melanogaster GN=CG11419 PE=1 SV=2)

HSP 1 Score: 74.7146 bits (182), Expect = 5.114e-13
Identity = 37/88 (42.05%), Postives = 60/88 (68.18%), Query Frame = 3
Query:   18 FHNLKEIKTVELVKPTGWVYISLSGNDPRDTFVNTFMLQIVVLSNHLNGRDTHVRQIKIYGP-RPNPIPHQQF-QFTSSEFNTYSTVR 275
            F++L+E++ ++L +PTGWV I +   + +   + TFMLQI V+SNH NGRDTH+RQI+I+ P      P + F +F + +F  ++T+R
Sbjct:  110 FNDLQELQVMDLTEPTGWVQIPIKDGNVKS--IRTFMLQIAVISNHQNGRDTHMRQIRIHAPVEGKHYPLELFGKFGTVDFQKFATIR 195          
The following BLAST results are available for this feature:
BLAST of EY756257 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
APC10_ARATH2.877e-4085.23Anaphase-promoting complex subunit 10 OS=Arabidops... [more]
APC10_MOUSE3.784e-1646.59Anaphase-promoting complex subunit 10 OS=Mus muscu... [more]
APC10_HUMAN3.784e-1646.59Anaphase-promoting complex subunit 10 OS=Homo sapi... [more]
APC10_BOVIN3.784e-1646.59Anaphase-promoting complex subunit 10 OS=Bos tauru... [more]
APC10_DROME5.114e-1342.05Anaphase-promoting complex subunit 10 OS=Drosophil... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-006-D08-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756257 ID=EY756257|Name=EY756257|organism=Citrus sinensis|type=EST|length=690bp
CCACGCGTCCGGATGGTTTTCATAACTTGAAGGAGATAAAAACTGTGGAA
CTTGTCAAGCCAACTGGGTGGGTCTATATATCGTTATCCGGAAATGATCC
TAGGGACACTTTTGTCAACACTTTTATGTTGCAAATTGTTGTGTTGTCAA
ACCATCTTAATGGGAGGGATACTCATGTGCGCCAGATCAAAATTTATGGA
CCTCGACCGAACCCCATTCCACATCAACAGTTTCAGTTTACATCAAGTGA
GTTTAACACTTACTCTACTGTGAGGTGAGGTCAGAAATTTGCTGCATAGT
GAAAGATCTGAATAGCCTTGTGGCATTTGCTGTGGGAAATAAAGCTTTGA
AGCTCAAAAATATTCAGATAATATAAGATTTTTACCATGTTCTTCAAGGC
ATGTACTACTCTAGTGTTATGATGTTAATGATCTCATATGGAACTGGGTA
TCCCTTAGCCTTAGGAGGTTCCGTAGTTCATGAGCTACTGCTTATGGTCA
CATCCCTCAAGTGAAGTCAATAACCGAGTTAGAAGAGAAAAAGAAACTGG
AAGGAGAAGACGATGATGGAATGTGAATGCTGCCAGTTAATTTTAACGGG
CTTCTTATGATGTTTCCTGGCATTGTTTGTTTTGATTGCAAAGCTTGTTT
TTTCACATTTTTATTATTATTATTAATTTATTTTGGTTGG
back to top