EY756252

Overview
NameEY756252
Unique NameEY756252
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length932
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY756252 vs. ExPASy Swiss-Prot
Match: HSP7S_PEA (Stromal 70 kDa heat shock-related protein, chloroplastic OS=Pisum sativum GN=HSP70 PE=2 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 2.467e-81
Identity = 158/213 (74.18%), Postives = 169/213 (79.34%), Query Frame = 3
Query:   12 QTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQIEVKFDIDANGILSVSAVDKGTGKKQDITITGASTLPNDEVQRMVQEAERFAKEDKEKRDAIDTKNQADSVVYQTEKQLKELGDKVPAXXXXXXXXXXXXXXDAIAEGSTQAMKDTMAALNQEVMQLGQSLYNQXXXXXXXXXXXXXXXXXXXSDSSNKGQDGDVIDADFTDSK 650
            QTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQIEVKFDIDANGILSV+A+DKGTGKKQDITITGASTLP DEV+RMV EAERF+KEDKEKR+AIDTKNQADSVVYQTEKQLKELG+KVPA              +AI  GSTQ +KD +AALNQEVMQLGQSLYNQ                     S  +G +GDVIDADFTDSK
Sbjct:  494 QTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQIEVKFDIDANGILSVAAIDKGTGKKQDITITGASTLPGDEVERMVSEAERFSKEDKEKREAIDTKNQADSVVYQTEKQLKELGEKVPAPVKEKVEAKLGELKEAITGGSTQTIKDALAALNQEVMQLGQSLYNQPGAAGQAGPTPPGSESGPSESSGKEGPEGDVIDADFTDSK 706          
BLAST of EY756252 vs. ExPASy Swiss-Prot
Match: HSP7S_SPIOL (Stromal 70 kDa heat shock-related protein, chloroplastic (Fragment) OS=Spinacia oleracea GN=CHSP70 PE=2 SV=1)

HSP 1 Score: 279.641 bits (714), Expect = 1.712e-74
Identity = 143/173 (82.66%), Postives = 151/173 (87.28%), Query Frame = 3
Query:   12 QTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQIEVKFDIDANGILSVSAVDKGTGKKQDITITGASTLPNDEVQRMVQEAERFAKEDKEKRDAIDTKNQADSVVYQTEKQLKELGDKVPAXXXXXXXXXXXXXXDAIAEGSTQAMKDTMAALNQEVMQLGQSLYNQ 530
            QTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQ+EVKFDIDANGILSV+A+DKGTGKKQDITITGASTLP DEV+RMV EAE+FAKEDKEKR+ IDTKNQADSVVYQTEKQLKELG+KVP               DAI  G TQA+KD MAALNQEVMQLGQSLYNQ
Sbjct:  374 QTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQVEVKFDIDANGILSVTAIDKGTGKKQDITITGASTLPGDEVERMVSEAEKFAKEDKEKREVIDTKNQADSVVYQTEKQLKELGEKVPVPVKEKVEAKLGELKDAINGGETQAIKDAMAALNQEVMQLGQSLYNQ 546          
BLAST of EY756252 vs. ExPASy Swiss-Prot
Match: DNAK2_PROMP (Chaperone protein dnaK2 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=dnaK2 PE=2 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 1.363e-55
Identity = 118/213 (55.40%), Postives = 148/213 (69.48%), Query Frame = 3
Query:   12 QTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQIEVKFDIDANGILSVSAVDKGTGKKQDITITGASTLPNDEVQRMVQEAERFAKEDKEKRDAIDTKNQADSVVYQTEKQLKELGDKVPAXXXXXXXXXXXXXXDAIAEGSTQAMKDTMAALNQEVMQLGQSLYNQXXXXXXXXXXXXXXXXXXXSDSSNKGQDGDVIDADFTDSK 650
            QT+VEI+VLQGERE   DNKSLG+FRLDGIP APRGVPQIEV FDIDANGILSV+A DKG+GK+Q I+ITGASTL ++EV +MV++AE  A  DKEKR+ ID KNQA+++VYQTEKQL ELGDKV A              +A ++   +AMK  +  L QE+  +G S+Y Q                   ++S++KG D DVIDADFT++K
Sbjct:  427 QTNVEIHVLQGEREMASDNKSLGTFRLDGIPSAPRGVPQIEVTFDIDANGILSVTAKDKGSGKEQSISITGASTLSDNEVDKMVKDAESNASVDKEKREKIDLKNQAETLVYQTEKQLGELGDKVDASAKAKVEEKSKALKEATSKEDYEAMKKLLEELQQELYAIGSSVYQQ------PGNQPPAPGTPDSNESNDKGGDDDVIDADFTETK 633          
BLAST of EY756252 vs. ExPASy Swiss-Prot
Match: DNAK_GUITH (Chaperone protein dnaK OS=Guillardia theta GN=dnaK PE=3 SV=2)

HSP 1 Score: 212.616 bits (540), Expect = 2.571e-54
Identity = 118/213 (55.40%), Postives = 143/213 (67.14%), Query Frame = 3
Query:   12 QTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQIEVKFDIDANGILSVSAVDKGTGKKQDITITGASTLPNDEVQRMVQEAERFAKEDKEKRDAIDTKNQADSVVYQTEKQLKELGDKVPAXXXXXXXXXXXXXXDAIAEGSTQAMKDTMAALNQEVMQLGQSLYNQXXXXXXXXXXXXXXXXXXXSDSSNKGQDGDVIDADFTDSK 650
            Q +VEI+VLQGEREF +DNKSLG+FRLDGI PAPRGVPQIEV FDIDANGILSV+A DKGTGK+Q ITITGASTLP+DEV+RMV EA+  AKEDKEKRD ID KNQ+DS+ YQ+EKQLKEL  K+                +AI   +   M+D  + L   +M LG+S+Y +                   S SS    +  VIDADF+++K
Sbjct:  428 QPNVEIHVLQGEREFAKDNKSLGTFRLDGILPAPRGVPQIEVTFDIDANGILSVTAKDKGTGKEQSITITGASTLPSDEVERMVNEAQNSAKEDKEKRDKIDLKNQSDSLCYQSEKQLKELEGKIDDTNKNKISSMISELRNAINNENYDEMRDLNSKLQTALMDLGKSVYEK-------------TSKEQTSTSSPTNSNDSVIDADFSETK 627          
BLAST of EY756252 vs. ExPASy Swiss-Prot
Match: DNAK_PROM5 (Chaperone protein dnaK OS=Prochlorococcus marinus (strain MIT 9515) GN=dnaK PE=2 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 7.480e-54
Identity = 116/213 (54.46%), Postives = 144/213 (67.61%), Query Frame = 3
Query:   12 QTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQIEVKFDIDANGILSVSAVDKGTGKKQDITITGASTLPNDEVQRMVQEAERFAKEDKEKRDAIDTKNQADSVVYQTEKQLKELGDKVPAXXXXXXXXXXXXXXDAIAEGSTQAMKDTMAALNQEVMQLGQSLYNQXXXXXXXXXXXXXXXXXXXSDSSNKGQDGDVIDADFTDSK 650
            QT+VEI+VLQGERE   DNKSLG+FRLDGIP APRGVPQIEV FDIDANGILSV+A DKG+GK+Q I+ITGASTL ++EV +MV++AE  A  DKEKR+ ID KNQA+++VYQTEKQL ELGDKV                +A ++    +MK  +  L QE+  +G S+Y Q                   + S +KG D DVIDADFT++K
Sbjct:  427 QTNVEIHVLQGEREMASDNKSLGTFRLDGIPSAPRGVPQIEVTFDIDANGILSVTAKDKGSGKEQSISITGASTLSDNEVDKMVKDAESNASVDKEKREKIDLKNQAETLVYQTEKQLGELGDKVDDSAKAKVEEKSKALKEATSKEDYDSMKKLLEELQQELYAIGSSVYQQ------PGNQPPAPGGPNANASDDKGPDDDVIDADFTETK 633          
BLAST of EY756252 vs. ExPASy Swiss-Prot
Match: DNAK2_PROMA (Chaperone protein dnaK2 OS=Prochlorococcus marinus GN=dnaK2 PE=2 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 9.769e-54
Identity = 117/213 (54.93%), Postives = 146/213 (68.54%), Query Frame = 3
Query:   12 QTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQIEVKFDIDANGILSVSAVDKGTGKKQDITITGASTLPNDEVQRMVQEAERFAKEDKEKRDAIDTKNQADSVVYQTEKQLKELGDKVPAXXXXXXXXXXXXXXDAIAEGSTQAMKDTMAALNQEVMQLGQSLYNQXXXXXXXXXXXXXXXXXXXSDSSNKGQDGDVIDADFTDSK 650
            QT+VEI+VLQGERE   DNKSLG+FRLDGIPP+PRGVPQIEV FDIDANGILSV+A DKG+GK+Q I+ITGASTL ++EV++MV++AE  A  DKEKRD ID KNQA+++VYQTEKQL ELGDKV                +A  +   + MK  +  L +E+  LG S+Y Q                   S++S +G D DVIDA+FT+SK
Sbjct:  427 QTNVEIHVLQGEREMASDNKSLGTFRLDGIPPSPRGVPQIEVTFDIDANGILSVTAKDKGSGKEQSISITGASTLSDNEVEKMVKDAETNATADKEKRDRIDIKNQAETLVYQTEKQLGELGDKVDEEAKAKVEAKRIQLKEATEKDDYETMKTLVEDLQKELYSLGASVYQQ-----SNAASQAADGTSSESNNSTEGND-DVIDAEFTESK 633          
BLAST of EY756252 vs. ExPASy Swiss-Prot
Match: DNAK2_ANASP (Chaperone protein dnaK2 OS=Anabaena sp. (strain PCC 7120) GN=dnaK2 PE=2 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 9.769e-54
Identity = 114/215 (53.02%), Postives = 141/215 (65.58%), Query Frame = 3
Query:   12 QTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQIEVKFDIDANGILSVSAVDKGTGKKQDITITGASTLPNDEVQRMVQEAERFAKEDKEKRDAIDTKNQADSVVYQTEKQLKELGDKVPAXXXXXXXXXXXXXXDAIAEGSTQAMKDTMAALNQEVMQLGQSLYNQXXXXXXXXXXXXXXXXXXXSDSSNKGQDG--DVIDADFTDSK 650
            QT+VEI+VLQGEREF  DNKSLG+FRLDGIPPAPRGVPQIEV FDIDANGIL+V+A DKGTGK+Q I+ITGASTL   ++ RMV+EAE+ A  DKE+R+ I+ KNQADS+ YQ EKQL+ELGDKVP               +A+A+   + +K     L Q +  +G ++Y Q                    D      DG  DVIDADFT++K
Sbjct:  427 QTNVEIHVLQGEREFANDNKSLGTFRLDGIPPAPRGVPQIEVVFDIDANGILNVTAKDKGTGKEQSISITGASTLDKTDIDRMVREAEQNASSDKERREKIERKNQADSLAYQAEKQLQELGDKVPEADKTKVEGLVKDLREAVAKEDDEQIKKLTPELQQALFAVGSNIYQQ--------AGGGAAPGAAPQDGGTTSSDGGDDVIDADFTETK 633          
BLAST of EY756252 vs. ExPASy Swiss-Prot
Match: DNAK2_SYNE7 (Chaperone protein dnaK2 OS=Synechococcus elongatus (strain PCC 7942) GN=dnaK2 PE=3 SV=2)

HSP 1 Score: 209.149 bits (531), Expect = 2.842e-53
Identity = 115/213 (53.99%), Postives = 142/213 (66.67%), Query Frame = 3
Query:   12 QTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQIEVKFDIDANGILSVSAVDKGTGKKQDITITGASTLPNDEVQRMVQEAERFAKEDKEKRDAIDTKNQADSVVYQTEKQLKELGDKVPAXXXXXXXXXXXXXXDAIAEGSTQAMKDTMAALNQEVMQLGQSLYNQXXXXXXXXXXXXXXXXXXXSDSSNKGQDGDVIDADFTDSK 650
            QT+VEI+VLQGERE   DNKSLG+FRLDGIPPAPRGVPQIEV FDIDANGIL+V+A DKG+GK+Q I+ITGASTL ++EV RMV++AE  A  DKE+R+ ID KNQAD++VYQ+EKQL ELGDK+ A              DA+A      +K  +  L Q +   G S+Y Q                   S SS+   D DVIDA+F++SK
Sbjct:  427 QTNVEIHVLQGEREMASDNKSLGTFRLDGIPPAPRGVPQIEVIFDIDANGILNVTAKDKGSGKEQSISITGASTLSDNEVDRMVKDAEANAAADKERRERIDLKNQADTLVYQSEKQLSELGDKISADEKSKVEGFIQELKDALAAEDYDKIKSIIEQLQQALYAAGSSVYQQ-----ASAEASANAQAGPSSSSSSSSGDDDVIDAEFSESK 634          
BLAST of EY756252 vs. ExPASy Swiss-Prot
Match: DNAK_PROMT (Chaperone protein dnaK OS=Prochlorococcus marinus (strain NATL2A) GN=dnaK PE=2 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 4.848e-53
Identity = 114/213 (53.52%), Postives = 143/213 (67.14%), Query Frame = 3
Query:   12 QTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQIEVKFDIDANGILSVSAVDKGTGKKQDITITGASTLPNDEVQRMVQEAERFAKEDKEKRDAIDTKNQADSVVYQTEKQLKELGDKVPAXXXXXXXXXXXXXXDAIAEGSTQAMKDTMAALNQEVMQLGQSLYNQXXXXXXXXXXXXXXXXXXXSDSSNKGQDGDVIDADFTDSK 650
            QT+VEI+VLQGERE   DNKSLG+FRLDGIPPAPRGVPQIEV FDIDANGILSV+A DKG+GK+Q I+ITGASTL ++EV +MV++AE  A  DKEKR+ ID KNQA+++VYQ EKQ+ ELGDKV                +A  +   ++MK  +  L QE+  LG S+Y Q                   S++ +K    DVIDADFT++K
Sbjct:  427 QTNVEIHVLQGEREMASDNKSLGTFRLDGIPPAPRGVPQIEVTFDIDANGILSVNAKDKGSGKEQSISITGASTLSDNEVDKMVKDAEMNASADKEKREKIDIKNQAETLVYQAEKQIGELGDKVDEAAKAKVEEKRIKLKEATEKDDYESMKTLVEELQQELYSLGASVYQQ---------ANDASQAAADSNTDSKVDGDDVIDADFTETK 630          
BLAST of EY756252 vs. ExPASy Swiss-Prot
Match: DNAK2_PROMM (Chaperone protein dnaK2 OS=Prochlorococcus marinus (strain MIT 9313) GN=dnaK2 PE=2 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 8.270e-53
Identity = 116/213 (54.46%), Postives = 140/213 (65.73%), Query Frame = 3
Query:   12 QTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQIEVKFDIDANGILSVSAVDKGTGKKQDITITGASTLPNDEVQRMVQEAERFAKEDKEKRDAIDTKNQADSVVYQTEKQLKELGDKVPAXXXXXXXXXXXXXXDAIAEGSTQAMKDTMAALNQEVMQLGQSLYNQXXXXXXXXXXXXXXXXXXXSDSSNKGQDGDVIDADFTDSK 650
            QT+VEI+VLQGERE   DNKSLG+FRLDGIPPAPRGVPQIEV FDIDANGILSV+A DKG+GK+Q I+ITGASTL  +EV++MV++AE  A  DKEKR+ ID KNQA+++VYQ EKQL EL DKV A               AI +    AMK  +  L QE+  +G S+Y Q                   S S +     DVIDA+FT+SK
Sbjct:  427 QTNVEIHVLQGEREMASDNKSLGTFRLDGIPPAPRGVPQIEVTFDIDANGILSVNAKDKGSGKEQSISITGASTLSENEVEKMVKDAETNASADKEKRERIDIKNQAETLVYQAEKQLGELADKVDADSKAKVEDKRVKLKAAIEKDDFDAMKSLLEELQQELYTVGASVYQQAGAAAAESGADAGAAGAGDSSSGD-----DVIDAEFTESK 634          
The following BLAST results are available for this feature:
BLAST of EY756252 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
HSP7S_PEA2.467e-8174.18Stromal 70 kDa heat shock-related protein, chlorop... [more]
HSP7S_SPIOL1.712e-7482.66Stromal 70 kDa heat shock-related protein, chlorop... [more]
DNAK2_PROMP1.363e-5555.40Chaperone protein dnaK2 OS=Prochlorococcus marinus... [more]
DNAK_GUITH2.571e-5455.40Chaperone protein dnaK OS=Guillardia theta GN=dnaK... [more]
DNAK_PROM57.480e-5454.46Chaperone protein dnaK OS=Prochlorococcus marinus ... [more]
DNAK2_PROMA9.769e-5454.93Chaperone protein dnaK2 OS=Prochlorococcus marinus... [more]
DNAK2_ANASP9.769e-5453.02Chaperone protein dnaK2 OS=Anabaena sp. (strain PC... [more]
DNAK2_SYNE72.842e-5353.99Chaperone protein dnaK2 OS=Synechococcus elongatus... [more]
DNAK_PROMT4.848e-5353.52Chaperone protein dnaK OS=Prochlorococcus marinus ... [more]
DNAK2_PROMM8.270e-5354.46Chaperone protein dnaK2 OS=Prochlorococcus marinus... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-006-D03-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756252 ID=EY756252|Name=EY756252|organism=Citrus sinensis|type=EST|length=932bp
CCACGCGTCCGCAGACCAGTGTCGAGATCAATGTTCTCCAAGGTGAAAGA
GAATTCGTGAGGGACAACAAATCTCTTGGCAGCTTCCGTCTTGATGGCAT
CCCTCCAGCACCGCGTGGGGTTCCTCAAATTGAGGTTAAATTTGACATCG
ATGCCAATGGTATTCTTTCTGTCTCTGCTGTTGACAAAGGCACCGGAAAG
AAACAAGACATCACCATTACTGGTGCTAGCACTTTACCCAATGATGAGGT
GCAAAGAATGGTGCAAGAAGCTGAGAGATTTGCCAAGGAGGATAAAGAGA
AAAGAGATGCTATTGACACCAAGAACCAGGCGGATTCTGTCGTATACCAA
ACGGAGAAACAGCTGAAGGAGCTGGGAGACAAGGTTCCAGCCGAAGTGAA
GGGGAAGGTCGAAGGAAAACTCAAGGAGCTCAAGGATGCAATTGCAGAGG
GTTCAACCCAAGCAATGAAGGACACTATGGCCGCCCTTAACCAAGAAGTT
ATGCAGCTTGGCCAGTCCCTTTACAACCAACCAGGAGCTGGGGCTGCACC
TGGCGCTGGACCTACTCCTGGTGCTGAGGCTGGAGCTTCAGACTCATCCA
ACAAAGGACAGGATGGTGATGTCATCGATGCAGATTTCACTGACAGCAAG
TGAAAATCTGCCTAGTTTTTGTCTTCCTAATTTATTGGATGNGTATAAGA
ATTTGATTTTGGCGGGATGTGATATAACTTGGGGTATGTCTCCAGTCATT
TTTGATGCATGGATAACAGAGTGAAATTGATTTANGAATATCGAGGATGG
TAGAGATACTAAGTAGGACACTNAAAGCAGAACATTTGCATTACNGNCAA
GCTGNTTTTATTAAAGCATATTGAGATGANTAAGCTTCGCTGCATTAAAA
AAAAAAAAAAAAAAAAAAAAGGCGGCGCTCTA
back to top