EY756176

Overview
NameEY756176
Unique NameEY756176
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length904
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY756176 vs. ExPASy Swiss-Prot
Match: WNK4_ORYSJ (Probable serine/threonine-protein kinase WNK4 OS=Oryza sativa subsp. japonica GN=WNK4 PE=2 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 5.899e-32
Identity = 71/113 (62.83%), Postives = 85/113 (75.22%), Query Frame = 3
Query:   33 MDIDSDYKQLSLSTCTESNNGSPHCPVLEFQRMHKNNEFRLRGTKNDDTSVSLTLRIADSSGRVRNIHFLFYLDSDTALSVAGEMVEQLDLADHDVAFIAEFIDYLIMKLLPG 371
            MD+D++ + +  STC  ++ G PH  VLEF R +KN E +L G K DD SVSL LRIAD  G  RNIHFLFYLDSDTA+SVA EMVEQL+LAD DV FIA+FID LI+ L+PG
Sbjct:  312 MDVDTN-ESMCTSTCKRNDLGGPHRSVLEFTRTNKNTELKLTGEKLDDNSVSLVLRIADLCGHARNIHFLFYLDSDTAMSVAAEMVEQLELADCDVTFIADFIDLLIVNLVPG 423          
BLAST of EY756176 vs. ExPASy Swiss-Prot
Match: WNK6_ARATH (Probable serine/threonine-protein kinase WNK6 OS=Arabidopsis thaliana GN=WNK6 PE=2 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 2.401e-25
Identity = 63/126 (50.00%), Postives = 83/126 (65.87%), Query Frame = 3
Query:    9 PPMSGPS---SMDIDSDYKQLSLSTCTESNNGSPHCPVLEFQRMHKNNEFRLRGTKNDDTSVSLTLRIADSSGRVRNIHFLFYLDSDTALSVAGEMVEQLDLADHDVAFIAEFIDYLIMKLLPGWK 377
            PP + PS   S+D+D D    +L   T S+N    C  +E +R  + N F L+G +ND+ SVSL LRI D +GRVRNIHFLFY + DTA  V+ EMVEQL+L D +V FIAE ID L++ ++P WK
Sbjct:  319 PPTTRPSKTLSIDLDEDS---NLPIVTFSDNSGSRC--IEVRRAKRGNFFVLKGEENDEQSVSLILRIVDENGRVRNIHFLFYQEGDTASKVSSEMVEQLELTDQNVTFIAELIDILLVNMIPTWK 439          
BLAST of EY756176 vs. ExPASy Swiss-Prot
Match: WNK7_ARATH (Probable serine/threonine-protein kinase WNK7 OS=Arabidopsis thaliana GN=WNK7 PE=2 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 1.556e-24
Identity = 59/116 (50.86%), Postives = 79/116 (68.10%), Query Frame = 3
Query:   30 SMDIDSDYKQLSLSTCTESNNGSPHCPVLEFQRMHKNNEFRLRGTKNDDTSVSLTLRIADSSGRVRNIHFLFYLDSDTALSVAGEMVEQLDLADHDVAFIAEFIDYLIMKLLPGWK 377
            SM++D D    +L     SNN   +C  +E +R  + N F L+G +ND+ SVSL LRI D +GRVRNIHFLF+ + DTA +V+ EMVEQL+L D +V FIAE ID L++ L+P WK
Sbjct:  328 SMNLDEDN---NLPIVISSNNSGTNC--IEVRRAKRGNFFVLKGEENDENSVSLILRIVDENGRVRNIHFLFFQEGDTASNVSSEMVEQLELTDKNVKFIAELIDVLLVNLIPNWK 438          
BLAST of EY756176 vs. ExPASy Swiss-Prot
Match: WNK8_ARATH (Serine/threonine-protein kinase WNK8 OS=Arabidopsis thaliana GN=WNK8 PE=1 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 1.456e-22
Identity = 78/251 (31.08%), Postives = 118/251 (47.01%), Query Frame = 3
Query:    6 RPPMSGPSSMDIDSDYKQLSLSTCTESNNGSPHCPVLEFQRMHKNNEFRLRGTKNDDTSVSLTLRIADSSGRVRNIHFLFYLDSDTALSVAGEMVEQLDLADHDVAFIAEFIDYLIMKLLPGWKPSYDYSSSGALSFYSVSPILGNGKTSTPSPWDAMGAGVPSEFVVKQDVVSGPTRNPSQDLAPAQGENLHDNAGGGGISFSSLGKLEESESQSSVASDIFVDDTSTKNDKASEIS--DYSTDRSYKDL 752
            RPP      MD+D +  +        SN   P    +E QR+ +N EFRLRG ++DD + S+ LRIAD SG+ R +HF FYL+SDTA ++A EMVE+L L   +V  IA+ ID  IM+LL     S+   +S  L+         N +T      +A G  + S+               S D       N  + A   G    S+    +S S  S   ++ + D     D  +E++  +   ++S++DL
Sbjct:  308 RPPQLEHLPMDVDHNENK-----SVSSNEDYPWSQTIELQRIAENKEFRLRGERSDDVTASMVLRIADPSGKCRIVHFAFYLESDTATAIAEEMVEELHLTSQEVVVIADMIDDFIMQLLSDRTSSHHNQNSPRLTHEDHE--AANQQTVNSKDEEAAGQSMKSDI--------------SADYYFPYSANDGNAAMEAGRDAESMSSYLDSCSMMSTIYNLSISDNDYPEDLKTELNLIESQFNQSFQDL 537          
BLAST of EY756176 vs. ExPASy Swiss-Prot
Match: WNK10_ARATH (Probable serine/threonine-protein kinase WNK10 OS=Arabidopsis thaliana GN=WNK10 PE=2 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 8.836e-20
Identity = 56/121 (46.28%), Postives = 77/121 (63.64%), Query Frame = 3
Query:    9 PPMSGPSSMDIDSDYKQLSLSTCTESNNGSPHCPVL---EFQRMHKNNEFRLRGTKNDDTSVSLTLRIADSSGRVRNIHFLFYLDSDTALSVAGEMVEQLDLADHDVAFIAEFIDYLIMKL 362
            PP      MD++   K  S+S C+ + + S  C +L   E QR+ ++ EF+L G + DD + S+ LRIA SSG+ R + F F L +DTA +V GEMVE+LDL+ H+V  IAE ID LIMKL
Sbjct:  296 PPQCEYRPMDVEYK-KNTSVSICSSAKS-SQECALLQTMEVQRVAESTEFKLSGERRDDVAASMALRIAGSSGQARKVDFDFNLKTDTARAVTGEMVEELDLSSHEVTVIAEMIDELIMKL 414          
BLAST of EY756176 vs. ExPASy Swiss-Prot
Match: WNK1_ORYSJ (Probable serine/threonine-protein kinase WNK1 OS=Oryza sativa subsp. japonica GN=WNK1 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 7.001e-17
Identity = 42/81 (51.85%), Postives = 59/81 (72.84%), Query Frame = 3
Query:  138 NNEFRLRGTKNDDTSVSLTLRIADSSGRVRNIHFLFYLDSDTALSVAGEMVEQLDLADHDVAFIAEFIDYLIMKLLPGWKP 380
            N +  ++G K++D S+ L LRIAD+ G VRNI+F F +++DTALSVA EMV +LD+ DH+V  IAE ID  +  L+P W+P
Sbjct:  362 NVDITIKGRKSEDGSIFLRLRIADNDGHVRNIYFPFDIEADTALSVATEMVAELDITDHEVTRIAEMIDGEVSALVPDWRP 442          
BLAST of EY756176 vs. ExPASy Swiss-Prot
Match: WNK1_ORYSI (Probable serine/threonine-protein kinase WNK1 OS=Oryza sativa subsp. indica GN=WNK1 PE=2 SV=2)

HSP 1 Score: 88.1965 bits (217), Expect = 7.001e-17
Identity = 42/81 (51.85%), Postives = 59/81 (72.84%), Query Frame = 3
Query:  138 NNEFRLRGTKNDDTSVSLTLRIADSSGRVRNIHFLFYLDSDTALSVAGEMVEQLDLADHDVAFIAEFIDYLIMKLLPGWKP 380
            N +  ++G K++D S+ L LRIAD+ G VRNI+F F +++DTALSVA EMV +LD+ DH+V  IAE ID  +  L+P W+P
Sbjct:  362 NVDITIKGRKSEDGSIFLRLRIADNDGHVRNIYFPFDIEADTALSVATEMVAELDITDHEVTRIAEMIDGEVSALVPDWRP 442          
BLAST of EY756176 vs. ExPASy Swiss-Prot
Match: WNK1_ARATH (Serine/threonine-protein kinase WNK1 OS=Arabidopsis thaliana GN=WNK1 PE=1 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 2.037e-16
Identity = 49/123 (39.84%), Postives = 73/123 (59.35%), Query Frame = 3
Query:  117 EFQRMHKNNEFRLRGTKNDDTSVSLTLRIADSSGRVRNIHFLFYLDSDTALSVAGEMVEQLDLADHDVAFIAEFIDYLIMKLLPGWKPSYDY----SSSGALSFYSVSPILGNGKTSTPSPWD 473
            E ++   N +  ++G + DD  + L LRIAD  GRVRNI+F F +++DTALSVA EMV +LD+ DH V  IA  ID  I  L+P W+P  ++    +++ A +  S+     + +TS  S  D
Sbjct:  381 EEEKKSGNVDITIKGKRRDDGGLFLRLRIADKEGRVRNIYFPFDIETDTALSVATEMVAELDMDDHGVTKIANMIDGEISSLVPSWRPGPEFEECLAAAAAANAASICNNCVSNRTSMGSVMD 503          
BLAST of EY756176 vs. ExPASy Swiss-Prot
Match: WNK2_ARATH (Serine/threonine-protein kinase WNK2 OS=Arabidopsis thaliana GN=WNK2 PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 9.462e-14
Identity = 40/86 (46.51%), Postives = 55/86 (63.95%), Query Frame = 3
Query:  144 EFRLRGTKNDDTSVSLTLRIADSSGRVRNIHFLFYLDSDTALSVAGEMVEQLDLADHDVAFIAEFIDYLIMKLLPGWKPSYDYSSS 401
            +  ++G +N D  + L LRI+D+ GR+RNI+F F    DTA SVA EMV +LD+ + DVA IAE ID  I  L+P WK   + S +
Sbjct:  341 DISIKGKRNGDDGIFLRLRISDAEGRIRNIYFPFETAIDTAWSVAVEMVSELDITNQDVAKIAEMIDAEIAALVPDWKNDTESSQN 426          
BLAST of EY756176 vs. ExPASy Swiss-Prot
Match: WNK3_ARATH (Probable serine/threonine-protein kinase WNK3 OS=Arabidopsis thaliana GN=WNK3 PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 6.133e-13
Identity = 42/112 (37.50%), Postives = 65/112 (58.04%), Query Frame = 3
Query:   51 YKQLSLSTCTESNNGSPHCPVLEFQRMHKNNEFRLRGTKNDDTSVSLTLRIADSSGRVRNIHFLFYLDSDTALSVAGEMVEQLDLA-DHDVAFIAEFIDYLIMKLLPGWKPS 383
            YK+ + +  +   NG     +++     +     + G + D  ++ L LRI DS G++RNIHF F +++DT+ SVA EMVE+LDL  D D++ IA+ ID  I   +P W PS
Sbjct:  283 YKENTENVSSHKENGYNGNGIVDKLSDSEVGLLTVEGQRKDLNTIFLKLRITDSKGQIRNIHFPFNIETDTSFSVAIEMVEELDLTDDQDISTIAKMIDTEIHSHIPDWTPS 394          
The following BLAST results are available for this feature:
BLAST of EY756176 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 13
Match NameE-valueIdentityDescription
WNK4_ORYSJ5.899e-3262.83Probable serine/threonine-protein kinase WNK4 OS=O... [more]
WNK6_ARATH2.401e-2550.00Probable serine/threonine-protein kinase WNK6 OS=A... [more]
WNK7_ARATH1.556e-2450.86Probable serine/threonine-protein kinase WNK7 OS=A... [more]
WNK8_ARATH1.456e-2231.08Serine/threonine-protein kinase WNK8 OS=Arabidopsi... [more]
WNK10_ARATH8.836e-2046.28Probable serine/threonine-protein kinase WNK10 OS=... [more]
WNK1_ORYSJ7.001e-1751.85Probable serine/threonine-protein kinase WNK1 OS=O... [more]
WNK1_ORYSI7.001e-1751.85Probable serine/threonine-protein kinase WNK1 OS=O... [more]
WNK1_ARATH2.037e-1639.84Serine/threonine-protein kinase WNK1 OS=Arabidopsi... [more]
WNK2_ARATH9.462e-1446.51Serine/threonine-protein kinase WNK2 OS=Arabidopsi... [more]
WNK3_ARATH6.133e-1337.50Probable serine/threonine-protein kinase WNK3 OS=A... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-005-E07-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756176 ID=EY756176|Name=EY756176|organism=Citrus sinensis|type=EST|length=904bp
CCACGCGTCCGCCCATGTCTGGACCCTCTTCCATGGATATAGACTCAGAC
TATAAGCAGCTCTCTTTAAGCACATGTACAGAAAGCAACAATGGAAGCCC
ACATTGTCCAGTTTTGGAATTTCAGAGGATGCATAAGAACAATGAGTTTA
GGCTGAGAGGGACAAAAAATGATGACACCTCTGTATCATTGACCTTGCGT
ATTGCTGACTCATCAGGTCGGGTGAGGAATATACATTTCCTCTTTTACCT
TGACAGTGATACTGCACTGTCAGTGGCAGGAGAGATGGTTGAACAACTAG
ACTTGGCGGATCATGATGTGGCCTTCATAGCTGAATTTATTGATTACTTG
ATAATGAAACTATTGCCTGGTTGGAAACCCTCATATGATTATTCCTCCAG
TGGAGCATTAAGTTTCTATAGTGTGTCTCCCATCCTGGGAAACGGCAAAA
CCTCAACACCATCCCCATGGGATGCAATGGGCGCTGGTGTTCCTTCTGAG
TTTGTGGTTAAGCAAGATGTTGTCTCTGGGCCTACTAGAAATCCTTCCCA
AGATCTTGCACCAGCACAAGGTGAAAACCTTCATGATAACGCCGGTGGAG
GAGGTATTTCTTTCTCCAGTTTGGGCAAATTGGAAGAATCAGAGTCACAA
TCGTCAGTTGCTTCAGATATTTTTGTTGACGATACTTCCACAAAAAATGA
TAAAGCATCTGAAATTTCTGACTACAGTACTGATAGAAGCTATAAGGACT
TGAATGGNTATGTATCTGAGTTAGAAACTAGGGGATTTGTGTATGATGAG
TGTAAATTGCAGGGAACTATAGCGAGGATGGAGAAACATCTTACTTTACC
AATTTGGGAAAAATCAAGCTGACGTTCCCAACCTGAGCCCGGATTGAACT
GGAC
back to top