EY756112

Overview
NameEY756112
Unique NameEY756112
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length612
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig11002 contig Csv1_Contig11002:328..940. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756112 vs. ExPASy Swiss-Prot
Match: CB4A_SOLLC (Chlorophyll a-b binding protein CP24 10A, chloroplastic OS=Solanum lycopersicum GN=CAP10A PE=3 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 7.767e-89
Identity = 150/164 (91.46%), Postives = 161/164 (98.17%), Query Frame = 1
Query:   13 GKDPAFLKWYREAELIHGRWAMAAVVGIFVGQAWSGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDRLKVAEIKHARLAMVAMLIFYFEAGQGKTP 504
            GKDPAFLKWYREAELIHGRWAMAAV+GIFVGQAWSGIPWFEAGADPGAIAPFSFG+LLGTQL+LMGWVESKRWVDFF+P+SQSVEWATPWS+TAENFAN TGEQGYPGGKFFDPL LAGT+ +GVY+PDTEKL+RLKVAEIKHARLAM+AMLIFYFEAGQGKTP
Sbjct:   87 GKDPAFLKWYREAELIHGRWAMAAVLGIFVGQAWSGIPWFEAGADPGAIAPFSFGTLLGTQLILMGWVESKRWVDFFDPDSQSVEWATPWSKTAENFANFTGEQGYPGGKFFDPLALAGTLNNGVYVPDTEKLERLKVAEIKHARLAMLAMLIFYFEAGQGKTP 250          
BLAST of EY756112 vs. ExPASy Swiss-Prot
Match: CB4B_SOLLC (Chlorophyll a-b binding protein CP24 10B, chloroplastic OS=Solanum lycopersicum GN=CAP10B PE=3 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 3.263e-87
Identity = 147/164 (89.63%), Postives = 160/164 (97.56%), Query Frame = 1
Query:   13 GKDPAFLKWYREAELIHGRWAMAAVVGIFVGQAWSGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDRLKVAEIKHARLAMVAMLIFYFEAGQGKTP 504
            GKDPAFLKWYREAELIHGRWAMAAV+GIFVGQAWSGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ +SQS++WATPWS+TAENFAN TGEQGYPGGKFFDPL LAGT+ +GVY+PDTEKL+RLK+AEIKH+RLAM+AMLIFYFEAGQGKTP
Sbjct:   87 GKDPAFLKWYREAELIHGRWAMAAVLGIFVGQAWSGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAENFANFTGEQGYPGGKFFDPLALAGTLNNGVYVPDTEKLERLKLAEIKHSRLAMLAMLIFYFEAGQGKTP 250          
BLAST of EY756112 vs. ExPASy Swiss-Prot
Match: CB4_SPIOL (Chlorophyll a-b binding protein CP24, chloroplastic OS=Spinacia oleracea PE=2 SV=1)

HSP 1 Score: 320.472 bits (820), Expect = 4.262e-87
Identity = 147/164 (89.63%), Postives = 160/164 (97.56%), Query Frame = 1
Query:   13 GKDPAFLKWYREAELIHGRWAMAAVVGIFVGQAWSGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDRLKVAEIKHARLAMVAMLIFYFEAGQGKTP 504
            GKDPAFLKWYREAELIHGRWAM AV+GIFVGQAW+GIPWFEAGADPGA+APFSFG+LLGTQLLLMGWVESKRWVDFF+P+SQSVEWATPWSRTAENF+N+TGEQGYPGGKFFDPL LAGTI +GVY PDT+KL+RLK+AEIKHARLAM+AMLIFYFEAGQGKTP
Sbjct:   92 GKDPAFLKWYREAELIHGRWAMLAVLGIFVGQAWTGIPWFEAGADPGAVAPFSFGTLLGTQLLLMGWVESKRWVDFFDPDSQSVEWATPWSRTAENFSNSTGEQGYPGGKFFDPLSLAGTISNGVYNPDTDKLERLKLAEIKHARLAMLAMLIFYFEAGQGKTP 255          
BLAST of EY756112 vs. ExPASy Swiss-Prot
Match: CB4C_ARATH (Chlorophyll a-b binding protein CP29.3, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.3 PE=1 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 9.368e-18
Identity = 64/164 (39.02%), Postives = 85/164 (51.83%), Query Frame = 1
Query:   40 YREAELIHGRWAMAAVVGIFVGQAWSGIPWFEAGADP--------GAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDRLKVAEIKHARLAMVAMLIFYFEAG-QGKTP 504
            +RE ELIHGRWAM   +G    +A +GI W +AG           G   PFS  +L+  ++L++G++E +R  +  +PE +                       YPGG +FDPL LA          D EKLD LK+AEIKH+RLAMVA LIF  +A   GK P
Sbjct:  137 FRECELIHGRWAMLGTLGAIAVEALTGIAWQDAGKVELVEGSSYLGQPLPFSLTTLIWIEVLVVGYIEFQRNSEL-DPEKRI----------------------YPGG-YFDPLGLAA---------DPEKLDTLKLAEIKHSRLAMVAFLIFALQAAFTGKGP 267          
BLAST of EY756112 vs. ExPASy Swiss-Prot
Match: CB4A_ARATH (Chlorophyll a-b binding protein CP29.1, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.1 PE=1 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 3.560e-17
Identity = 63/164 (38.41%), Postives = 85/164 (51.83%), Query Frame = 1
Query:   40 YREAELIHGRWAMAAVVGIFVGQAWSGIPWFEAG--------ADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDRLKVAEIKHARLAMVAMLIFYFE-AGQGKTP 504
            +RE ELIHGRWAM A +G    +  +G+ W +AG        +  G   PFS  +L+  ++L++G++E +R     N E  S                   ++ YPGGKFFDPL LA          D EK  +L++AEIKHARLAMVA L F  + A  GK P
Sbjct:  136 FRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKVELVDGSSYLGQPLPFSISTLIWIEVLVIGYIEFQR-----NAELDS------------------EKRLYPGGKFFDPLGLAA---------DPEKTAQLQLAEIKHARLAMVAFLGFAVQAAATGKGP 267          
BLAST of EY756112 vs. ExPASy Swiss-Prot
Match: CB4B_ARATH (Chlorophyll a-b binding protein CP29.2, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.2 PE=1 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 3.014e-16
Identity = 62/167 (37.13%), Postives = 85/167 (50.90%), Query Frame = 1
Query:   31 LKWYREAELIHGRWAMAAVVGIFVGQAWSGIPWFEAG--------ADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDRLKVAEIKHARLAMVAMLIFYFE-AGQGKTP 504
            L+ +RE ELIHGRWAM A +G    +  +G+ W +AG        +  G   PFS  +L+  ++L++G++E +R     N E  S                   ++ YPGGKFFDPL LA          D  K  +L++AEIKHARLAMV  L F  + A  GK P
Sbjct:  130 LQRFRECELIHGRWAMLATLGAITVEWLTGVTWQDAGKVELVDGSSYLGQPLPFSISTLIWIEVLVIGYIEFQR-----NAELDS------------------EKRLYPGGKFFDPLGLAS---------DPVKKAQLQLAEIKHARLAMVGFLGFAVQAAATGKGP 264          
BLAST of EY756112 vs. ExPASy Swiss-Prot
Match: CB12_PETHY (Chlorophyll a-b binding protein, chloroplastic OS=Petunia hybrida PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 3.936e-16
Identity = 53/163 (32.52%), Postives = 78/163 (47.85%), Query Frame = 1
Query:   13 GKDPAFLKWYREAELIHGRWAMAAVVGIFVGQAWSGI------PWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDRLKVAEIKHARLAMVAMLIFYFE 483
            G DP  LKW  +AEL+H RWAM    GIF+ +  + I       W+ AG            +L   +L+L+GW E +RW D   P   + +   P ++          + GYPGG +FDPL        G       K+  L+  EIK+ RLAM+A++  +F+
Sbjct:   94 GSDPESLKWNAQAELVHSRWAMLGAAGIFIPEFLTKIGVLNTPSWYTAGEQEYFT---DTTTLFVIELVLIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGT------DVGYPGGLWFDPL--------GWGSGSPAKIKELRTKEIKNGRLAMLAVMGAWFQ 239          
BLAST of EY756112 vs. ExPASy Swiss-Prot
Match: CB12_SOLLC (Chlorophyll a-b binding protein 7, chloroplastic OS=Solanum lycopersicum GN=CAB7 PE=3 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 4.352e-15
Identity = 51/161 (31.68%), Postives = 78/161 (48.45%), Query Frame = 1
Query:   19 DPAFLKWYREAELIHGRWAMAAVVGIFVGQAWSGI------PWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDRLKVAEIKHARLAMVAMLIFYFE 483
            DP  L+W ++AEL+H RWAM    GIF+ +  + I       W+ AG            +L   +L+L+GW E +RW D   P   + +   P ++          + GYPGG +FDPL        G       K+  L+  EIK+ RLAM+A++  +F+
Sbjct:   96 DPESLRWNQQAELVHCRWAMLGAAGIFIPELLTKIGILNTPSWYTAGEQEYFT---DTTTLFIVELVLIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGT------DVGYPGGLWFDPL--------GWGSGSPAKIKELRTKEIKNGRLAMLAVMGAWFQ 239          
BLAST of EY756112 vs. ExPASy Swiss-Prot
Match: CB29_CHLRE (Chlorophyll a-b binding protein CP29 OS=Chlamydomonas reinhardtii GN=Lhcb4 PE=1 SV=3)

HSP 1 Score: 80.8777 bits (198), Expect = 5.683e-15
Identity = 59/156 (37.82%), Postives = 76/156 (48.72%), Query Frame = 1
Query:   40 YREAELIHGRWAMAAVVGIFVGQAWSGIPWFEAG-------ADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDRLKVAEIKHARLAMVAMLIFYFEA 486
            +RE ELIHGRWAM A +G  V +A +G+ W EAG       +  G   PFS   L+  +++L+G  E  R  +  NPE +                       YPGG  FDPL LA          D E+  RLK AEIKHARLAMV+   +  +A
Sbjct:  133 FRECELIHGRWAMLACLGALVAEATTGVSWVEAGKVELDGASYAGLSLPFSITQLIWIEVILVGGAEFYRNSE-TNPEKRC----------------------YPGG-VFDPLKLAS--------EDEERAFRLKTAEIKHARLAMVSFFGYGVQA 256          
BLAST of EY756112 vs. ExPASy Swiss-Prot
Match: CB24_PEA (Chlorophyll a-b binding protein P4, chloroplastic OS=Pisum sativum GN=lhcA-P4 PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 9.074e-13
Identity = 54/170 (31.76%), Postives = 83/170 (48.82%), Query Frame = 1
Query:   16 KDPAFLKWYREAELIHGRWAMAAVVGIFVGQAWSGI------PWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDRLKVAEIKHARLAMVAMLIFYFEAG-QGKTP 504
            +DP  L+W+ +AEL++GRWAM  V G+ + + ++ I       W+ AG +       S  +L   + +L  +VE +RW D  NP S + +         + ++   GE GYPGG  F+PL  A T++              K  EI + RLAM+A L F  +    GK P
Sbjct:   83 EDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTSIGIINVPKWYAAGKEEYFA---SSSTLFVIEFILSHYVEIRRWQDIKNPGSVNQD------PIFKQYSLPAGEVGYPGG-IFNPLNFAPTLE-------------AKEKEIANGRLAMLAFLGFIIQHNVTGKGP 229          
The following BLAST results are available for this feature:
BLAST of EY756112 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
CB4A_SOLLC7.767e-8991.46Chlorophyll a-b binding protein CP24 10A, chloropl... [more]
CB4B_SOLLC3.263e-8789.63Chlorophyll a-b binding protein CP24 10B, chloropl... [more]
CB4_SPIOL4.262e-8789.63Chlorophyll a-b binding protein CP24, chloroplasti... [more]
CB4C_ARATH9.368e-1839.02Chlorophyll a-b binding protein CP29.3, chloroplas... [more]
CB4A_ARATH3.560e-1738.41Chlorophyll a-b binding protein CP29.1, chloroplas... [more]
CB4B_ARATH3.014e-1637.13Chlorophyll a-b binding protein CP29.2, chloroplas... [more]
CB12_PETHY3.936e-1632.52Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB12_SOLLC4.352e-1531.68Chlorophyll a-b binding protein 7, chloroplastic O... [more]
CB29_CHLRE5.683e-1537.82Chlorophyll a-b binding protein CP29 OS=Chlamydomo... [more]
CB24_PEA9.074e-1331.76Chlorophyll a-b binding protein P4, chloroplastic ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-003-G04-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756112 ID=EY756112|Name=EY756112|organism=Citrus sinensis|type=EST|length=612bp
CCACGCGTCCGTGGAAAGGACCCAGCATTCCTGAAATGGTACAGAGAAGC
AGAACTGATCCACGGACGATGGGCAATGGCTGCAGTTGTTGGGATATTCG
TCGGACAGGCGTGGAGTGGGATTCCATGGTTCGAGGCTGGAGCAGATCCT
GGAGCCATAGCACCCTTCTCCTTCGGCTCACTCCTGGGAACCCAGCTTCT
CCTTATGGGTTGGGTTGAGAGCAAGCGGTGGGTTGATTTTTTCAATCCTG
AATCTCAATCAGTTGAATGGGCAACACCTTGGTCAAGAACTGCTGAAAAC
TTTGCCAATGCGACTGGTGAACAAGGCTACCCTGGTGGAAAGTTTTTTGA
TCCCTTATGTTTGGCTGGAACAATTAAGGATGGTGTCTACATTCCTGACA
CTGAGAAGCTTGACAGGCTCAAAGTTGCTGAGATTAAACATGCTAGGCTT
GCTATGGTGGCCATGTTGATTTTCTACTTTGAAGCTGGCCAAGGCAAGAC
GCCACTTGGGGCTCTTGGTTTGTAAAACATGCTTATGTAGATAACTCACT
GATTGGTGTTAAGCGTAATCAATCGGATGTATATGAGTTCCCTCAAAAAA
AAAAAAAAAAAA
back to top