EY756110

Overview
NameEY756110
Unique NameEY756110
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length893
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY756110 vs. ExPASy Swiss-Prot
Match: BXL7_ARATH (Probable beta-D-xylosidase 7 OS=Arabidopsis thaliana GN=BXL7 PE=2 SV=2)

HSP 1 Score: 283.493 bits (724), Expect = 1.117e-75
Identity = 144/239 (60.25%), Postives = 179/239 (74.90%), Query Frame = 3
Query:   12 ALHNLFSVRMRLGLFNGNPTTQPFGKIGADVVCSPAHQVLALQAAQDGIVLLKNSHGXXXXXXXXXXXXXXIGPNANSAKTLLGNYAGPSCRSITPLQALQNYVENTVYYPGCDTVACSSASIDKAVDIAKGADHVVLMMGLDQTQEKEELDRVDLVLPGRQQELIHRVAEAANIPXILVLLW*GPVDITFAQYDRNIGSILWAGFPGELGAVH*KKSFSGTLS-RRKLPMTWYPQNFL 725
            AL NLFSVR+RLGLFNG+PT  P+G I  + VCSPAHQ LAL AA++GIVLLKN+                IGPNA+  KTLLGNYAGP C+++TPL AL++YV+N VY+ GCD+VACS+A+ID+AV IAK ADHVVL+MGLDQTQEKE+ DRVDL LPG+QQELI  VA AA  P +LVL+  GPVDI+FA  +  IGSI+WAG+PGE G +   +   G  +   +LP+TWYPQ+F+
Sbjct:  350 ALLNLFSVRIRLGLFNGDPTKLPYGNISPNEVCSPAHQALALDAARNGIVLLKNNLKLLPFSKRSVSSLAVIGPNAHVVKTLLGNYAGPPCKTVTPLDALRSYVKNAVYHQGCDSVACSNAAIDQAVAIAKNADHVVLIMGLDQTQEKEDFDRVDLSLPGKQQELITSVANAAKKPVVLVLICGGPVDISFAANNNKIGSIIWAGYPGEAGGIAISEIIFGDHNPGGRLPVTWYPQSFV 588          
BLAST of EY756110 vs. ExPASy Swiss-Prot
Match: BXL2_ARATH (Probable beta-D-xylosidase 2 OS=Arabidopsis thaliana GN=BXL2 PE=2 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 9.702e-55
Identity = 113/240 (47.08%), Postives = 155/240 (64.58%), Query Frame = 3
Query:   12 ALHNLFSVRMRLGLFNGNPTTQPFGKIGADVVCSPAHQVLALQAAQDGIVLLKNSHGXXXXXXXXXXXXXXIGPNANSAKTLLGNYAGPSCRSITPLQALQNYVENTVYYPGCDTVACSSASI-DKAVDIAKGADHVVLMMGLDQTQEKEELDRVDLVLPGRQQELIHRVAEAANIPXILVLLW*GPVDITFAQYDRNIGSILWAGFPGELGAVH*KKSFSGTLS-RRKLPMTWYPQNFL 725
            AL N  +V+MRLG+F+G+   QP+G +G   VC+P H+ LAL+AAQ GIVLLKN                 IGPN+++  T++GNYAG +C   +P+Q +  Y   T++  GC  V C    + D AV+ A+GAD  VL+MGLDQ+ E E  DR  L+LPG+QQEL+ RVA+AA  P ILVL+  GP+DI+FA+ DR I +I+WAG+PG+ G         G+ +   KLPMTWYPQ++L
Sbjct:  348 ALINTLTVQMRLGMFDGDIAAQPYGHLGPAHVCTPVHKGLALEAAQQGIVLLKNHGSSLPLSSQRHRTVAVIGPNSDATVTMIGNYAGVACGYTSPVQGITGYAR-TIHQKGCVDVHCMDDRLFDAAVEAARGADATVLVMGLDQSIEAEFKDRNSLLLPGKQQELVSRVAKAAKGPVILVLMSGGPIDISFAEKDRKIPAIVWAGYPGQEGGTAIADILFGSANPGGKLPMTWYPQDYL 586          

HSP 2 Score: 25.0238 bits (53), Expect = 9.702e-55
Identity = 15/39 (38.46%), Postives = 18/39 (46.15%), Query Frame = 1
Query:  733 MTGMKMHPKNFGE-SGRTFRFYKGKKASHLGWAPTIQRF 846
            MT M M P +     GRT+RFY G      G   +  RF
Sbjct:  591 MTEMSMRPVHSKRIPGRTYRFYDGPVVYPFGHGLSYTRF 629          
BLAST of EY756110 vs. ExPASy Swiss-Prot
Match: BXL3_ARATH (Beta-D-xylosidase 3 OS=Arabidopsis thaliana GN=BXL3 PE=1 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 3.496e-53
Identity = 123/277 (44.40%), Postives = 162/277 (58.48%), Query Frame = 3
Query:   12 ALHNLFSVRMRLGLFNGNPTTQPFGKIGADVVCSPAHQVLALQAAQDGIVLLKNSHGXXXXXXXXXXXXXXIGPNANSAKTLLGNYAGPSCRSITPLQALQNYVENTVYYPGCDTVACSSASIDKAVDIAKGADHVVLMMGLDQTQEKEELDRVDLVLPGRQQELIHRVAEAANIPXILVLLW*GPVDITFAQYDRNIGSILWAGFPGELGAVH*KKSFSGTLS-RRKLPMTWYPQNFLKYNDGHENAPQEFRGIRKDISILQREKGFPSRLGSHYS 839
            A+ N F+  MRLG F+G+P  Q +G +G   VC+  +Q LA   A+ GIVLLKNS G              IGPNAN+ +T++GNY G  C+  TPLQ L   V +T Y  GC+ VAC  A I  AVD+A  AD VVL++G DQ+ E+E  DRVDL LPG+QQEL+ RVA AA  P +LV++  G  DITFA+ D+ I SI+W G+PGE G +       G  +    LPMTWYPQ+++      E  P     +R D     + KG+P R    Y+
Sbjct:  356 AISNNFATLMRLGFFDGDPKKQLYGGLGPKDVCTADNQELARDGARQGIVLLKNSAGSLPLSPSAIKTLAVIGPNANATETMIGNYHGVPCKYTTPLQGLAETVSST-YQLGCN-VACVDADIGSAVDLAASADAVVLVVGADQSIEREGHDRVDLYLPGKQQELVTRVAMAARGPVVLVIMSGGGFDITFAKNDKKITSIMWVGYPGEAGGLAIADVIFGRHNPSGNLPMTWYPQSYV------EKVPMSNMNMRPD-----KSKGYPGRSYRFYT 619          
BLAST of EY756110 vs. ExPASy Swiss-Prot
Match: BXL4_ARATH (Beta-D-xylosidase 4 OS=Arabidopsis thaliana GN=BXL4 PE=1 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 5.964e-53
Identity = 122/277 (44.04%), Postives = 158/277 (57.04%), Query Frame = 3
Query:   12 ALHNLFSVRMRLGLFNGNPTTQPFGKIGADVVCSPAHQVLALQAAQDGIVLLKNSHGXXXXXXXXXXXXXXIGPNANSAKTLLGNYAGPSCRSITPLQALQNYVENTVYYPGCDTVACSSASIDKAVDIAKGADHVVLMMGLDQTQEKEELDRVDLVLPGRQQELIHRVAEAANIPXILVLLW*GPVDITFAQYDRNIGSILWAGFPGELGAVH*KKSFSGTLS-RRKLPMTWYPQNFLKYNDGHENAPQEFRGIRKDISILQREKGFPSRLGSHYS 839
            A+ N F   MRLG F+GNP  Q +G +G   VC+ A+Q LA  AA+ GIVLLKN+ G              IGPNAN  KT++GNY G  C+  TPLQ L   V +T Y PGC  VAC+ A +  A  +A  AD  VL++G DQ+ E E  DRVDL LPG+QQEL+ +VA+AA  P +LV++  G  DITFA+ D  I  ILW G+PGE G +       G  +   KLPMTWYPQ+++      E  P     +R D     +  G+P R    Y+
Sbjct:  366 AISNNFLTLMRLGFFDGNPKNQIYGGLGPTDVCTSANQELAADAARQGIVLLKNT-GCLPLSPKSIKTLAVIGPNANVTKTMIGNYEGTPCKYTTPLQGLAGTV-STTYLPGCSNVACAVADVAGATKLAATADVSVLVIGADQSIEAESRDRVDLHLPGQQQELVIQVAKAAKGPVLLVIMSGGGFDITFAKNDPKIAGILWVGYPGEAGGIAIADIIFGRYNPSGKLPMTWYPQSYV------EKVPMTIMNMRPD-----KASGYPGRTYRFYT 629          
BLAST of EY756110 vs. ExPASy Swiss-Prot
Match: XYNB_PRUPE (Putative beta-D-xylosidase (Fragment) OS=Prunus persica PE=2 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 5.049e-52
Identity = 116/277 (41.88%), Postives = 161/277 (58.12%), Query Frame = 3
Query:   12 ALHNLFSVRMRLGLFNGNPTTQPFGKIGADVVCSPAHQVLALQAAQDGIVLLKNSHGXXXXXXXXXXXXXXIGPNANSAKTLLGNYAGPSCRSITPLQALQNYVENTVYYPGCDTVACSSASIDKAVDIA-KGADHVVLMMGLDQTQEKEELDRVDLVLPGRQQELIHRVAEAANIPXILVLLW*GPVDITFAQYDRNIGSILWAGFPGELGAVH*KKSFSGTLS-RRKLPMTWYPQNFLKYNDGHENAPQEFRGIRKDISILQREKGFPSRLGSHY 836
            AL N  +V+MRLG+F+G P+   +G +G   VC+PAHQ LAL+AA+ GIVLL+N                 IGPN++   T++GNYAG +C   TPLQ +  Y   T++  GC  V C+   +  A + A + AD  VL+MGLDQ+ E E +DR  L+LPG QQEL+ RVA A+  P ILVL+  GP+D+TFA+ D  I +I+W G+PG+ G         GT +   KLPMTWYPQN++ +       P     +R D +     +G+P R    Y
Sbjct:   37 ALANTMTVQMRLGMFDGEPSAHQYGNLGPRDVCTPAHQQLALEAARQGIVLLENRGRSLPLSTRRHRTVAVIGPNSDVTVTMIGNYAGVACGYTTPLQGIGRYTR-TIHQAGCTDVHCNGNQLFGAAEAAARQADATVLVMGLDQSIEAEFVDRAGLLLPGHQQELVSRVARASRGPTILVLMSGGPIDVTFAKNDPRISAIIWVGYPGQAGGTAIANVLFGTANPGGKLPMTWYPQNYVTH------LPMTDMAMRADPA-----RGYPGRTYRFY 301          
BLAST of EY756110 vs. ExPASy Swiss-Prot
Match: BXL5_ARATH (Probable beta-D-xylosidase 5 OS=Arabidopsis thaliana GN=BXL5 PE=2 SV=2)

HSP 1 Score: 193.741 bits (491), Expect = 1.624e-51
Identity = 108/235 (45.96%), Postives = 142/235 (60.43%), Query Frame = 3
Query:   27 FSVRMRLGLFNGNPTTQPFGKIGADVVCSPAHQVLALQAAQDGIVLLKNSHGXXXXXXXXXXXXXXIGPNANSAKTLLGNYAGPSCRSITPLQALQNYV-ENTVYYPGCDTVACSSAS-IDKAVDIAKGADHVVLMMGLDQTQEKEELDRVDLVLPGRQQELIHRVAEAANIPXILVLLW*GPVDITFAQYDRNIGSILWAGFPGELGAVH*KKSFSGTLS-RRKLPMTWYPQNF 722
            + V MRLG F+G+P + PFG +G   VCS  HQ+LAL+AA+ GIVLL+N  G              IGPNAN+ K ++ NYAG  C+  +P+Q LQ YV E  VY PGC  V C   + I  AV     AD  VL++GLDQT E E LDRV+L LPG Q++L+  VA AA    +LV++  GP+DI+FA+    I ++LW G+PGE G     +   G  +   +LP TWYPQ F
Sbjct:  354 YIVLMRLGFFDGDPKSLPFGNLGPSDVCSKDHQMLALEAAKQGIVLLEN-RGDLPLPKTTVKKLAVIGPNANATKVMISNYAGVPCKYTSPIQGLQKYVPEKIVYEPGCKDVKCGDQTLISAAVKAVSEADVTVLVVGLDQTVEAEGLDRVNLTLPGYQEKLVRDVANAAKKTVVLVIMSAGPIDISFAKNLSTIRAVLWVGYPGEAGGDAIAQVIFGDYNPSGRLPETWYPQEF 587          

HSP 2 Score: 30.0314 bits (66), Expect = 1.624e-51
Identity = 16/42 (38.10%), Postives = 21/42 (50.00%), Query Frame = 1
Query:  733 MTGMKMHPKNF-GESGRTFRFYKGKKASHLGWAPTIQRFLQF 855
            MT M M P +  G  GR++RFY GK     G+  +   F  F
Sbjct:  593 MTDMNMRPNSTSGFPGRSYRFYTGKPIYKFGYGLSYSSFSTF 634          
BLAST of EY756110 vs. ExPASy Swiss-Prot
Match: BXL6_ARATH (Probable beta-D-xylosidase 6 OS=Arabidopsis thaliana GN=BXL6 PE=2 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 5.582e-51
Identity = 107/239 (44.77%), Postives = 146/239 (61.09%), Query Frame = 3
Query:   12 ALHNLFSVRMRLGLFNGNPTTQPFGKIGADVVCSPAHQVLALQAAQDGIVLLKNSHGXXXXXXXXXXXXXXIGPNANSAKTLLGNYAGPSCRSITPLQALQNYVENTVYYPGCDTVACSS-ASIDKAVDIAKGADHVVLMMGLDQTQEKEELDRVDLVLPGRQQELIHRVAEAANIPXILVLLW*GPVDITFAQYDRNIGSILWAGFPGELGAVH*KKSFSGTLS-RRKLPMTWYPQNF 722
            AL NLF+V++RLGLF+G+P    +GK+G++ +CS  H+ LAL+A + GIVLLKN H               +GP AN+   + G Y G  C+  T    L  YV+ T Y  GC  V+C S     +AV IAKGAD V+++ GLD +QE E+ DRV L LPG+Q++L+  VA  +  P ILVL   GPVD+TFA+ D  IGSI+W G+PGE G     +   G  +   +LP TWYP++F
Sbjct:  367 ALLNLFAVQLRLGLFDGDPRRGQYGKLGSNDICSSDHRKLALEATRQGIVLLKNDHKLLPLNKNHVSSLAIVGPMANNISNMGGTYTGKPCQRKTLFTELLEYVKKTSYASGCSDVSCDSDTGFGEAVAIAKGADFVIVVAGLDLSQETEDKDRVSLSLPGKQKDLVSHVAAVSKKPVILVLTGGGPVDVTFAKNDPRIGSIIWIGYPGETGGQALAEIIFGDFNPGGRLPTTWYPESF 605          
BLAST of EY756110 vs. ExPASy Swiss-Prot
Match: BXL1_ARATH (Beta-D-xylosidase 1 OS=Arabidopsis thaliana GN=BXL1 PE=1 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 6.635e-50
Identity = 107/240 (44.58%), Postives = 148/240 (61.67%), Query Frame = 3
Query:   12 ALHNLFSVRMRLGLFNGNPTTQPFGKIGADVVCSPAHQVLALQAAQDGIVLLKNSHGXXXXXXXXXXXXXXIGPNANSAKTLLGNYAGPSCRSITPLQALQNYVENTVYYPGCDTVACS-SASIDKAVDIAKGADHVVLMMGLDQTQEKEELDRVDLVLPGRQQELIHRVAEAANIPXILVLLW*GPVDITFAQYDRNIGSILWAGFPGELGAVH*KKSFSGTLS-RRKLPMTWYPQNFL 725
            AL N  +V+MRLG+F+GN    P+  +G   VC+PAH+ LAL+AA  GIVLLKNS                IGPN++  +T++GNYAG +C   +PLQ +  Y   T++  GC  VAC  +     A   A+ AD  VL+MGLDQ+ E E  DR  L+LPG QQ+L+ RVA+A+  P ILVL+  GP+D+TFA+ D  + +I+WAG+PG+ G         G  +   KLPMTWYPQ+++
Sbjct:  354 ALANTLTVQMRLGMFDGN--LGPYANLGPRDVCTPAHKHLALEAAHQGIVLLKNSARSLPLSPRRHRTVAVIGPNSDVTETMIGNYAGKACAYTSPLQGISRYAR-TLHQAGCAGVACKGNQGFGAAEAAAREADATVLVMGLDQSIEAETRDRTGLLLPGYQQDLVTRVAQASRGPVILVLMSGGPIDVTFAKNDPRVAAIIWAGYPGQAGGAAIANIIFGAANPGGKLPMTWYPQDYV 590          

HSP 2 Score: 23.483 bits (49), Expect = 6.635e-50
Identity = 10/24 (41.67%), Postives = 13/24 (54.17%), Query Frame = 1
Query:  775 GRTFRFYKGKKASHLGWAPTIQRF 846
            GRT+RFYKG      G+  +   F
Sbjct:  608 GRTYRFYKGPVVFPFGFGLSYTTF 631          
The following BLAST results are available for this feature:
BLAST of EY756110 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
BXL7_ARATH1.117e-7560.25Probable beta-D-xylosidase 7 OS=Arabidopsis thalia... [more]
BXL2_ARATH9.702e-5547.08Probable beta-D-xylosidase 2 OS=Arabidopsis thalia... [more]
BXL3_ARATH3.496e-5344.40Beta-D-xylosidase 3 OS=Arabidopsis thaliana GN=BXL... [more]
BXL4_ARATH5.964e-5344.04Beta-D-xylosidase 4 OS=Arabidopsis thaliana GN=BXL... [more]
XYNB_PRUPE5.049e-5241.88Putative beta-D-xylosidase (Fragment) OS=Prunus pe... [more]
BXL5_ARATH1.624e-5145.96Probable beta-D-xylosidase 5 OS=Arabidopsis thalia... [more]
BXL6_ARATH5.582e-5144.77Probable beta-D-xylosidase 6 OS=Arabidopsis thalia... [more]
BXL1_ARATH6.635e-5044.58Beta-D-xylosidase 1 OS=Arabidopsis thaliana GN=BXL... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-003-G02-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756110 ID=EY756110|Name=EY756110|organism=Citrus sinensis|type=EST|length=893bp
CCACGCGTCCGGCCCTTCACAATCTTTTTTCTGTTAGAATGAGGTTAGGA
CTCTTCAATGGCAACCCAACAACACAGCCTTTTGGCAAAATAGGAGCGGA
CGTTGTCTGCTCTCCTGCTCACCAGGTTCTAGCCCTTCAAGCAGCTCAAG
ATGGAATTGTCCTGCTGAAGAACTCTCACGGGCTCCTCCCACTGCCAAAA
TCAAAATCTGTGTCTCTTGCGCTAATTGGTCCTAATGCCAATTCTGCAAA
AACACTTCTAGGAAACTATGCAGGTCCTTCTTGCAGATCCATTACCCCAT
TGCAAGCATTGCAAAACTATGTTGAGAACACAGTTTATTACCCTGGTTGC
GATACAGTGGCCTGCTCTTCAGCTTCAATTGACAAGGCAGTGGACATAGC
AAAAGGGGCTGATCATGTGGTGCTGATGATGGGATTGGACCAAACTCAAG
AGAAGGAGGAGCTTGATCGTGTGGACTTGGTGCTTCCTGGAAGGCAACAA
GAACTCATCCACAGAGTTGCAGAAGCTGCCAACATACCAGNTATTCTGGT
TCTTCTTTGGTGAGGTCCTGTTGATATAACTTTTGCCCAGTACGACCGCA
ATATTGGAAGCATTCTGTGGGCAGGTTTTCCTGGTGAACTTGGAGCGGTG
CACTAAAAGAAGTCATTTTCGGGGACATTATCCAGGAGGAAATTACCGAT
GACTTGGTATCCCCAAAATTTTTTAAAATACAATGACGGGCATGAAAATG
CACCCCAAGAATTTCGGGGAATCCGGAAGGACATTTCGATTCTACAAAGG
GAAAAAGGCTTCCCATCTCGGTTGGGCTCCCACTATTCAAAGATTTCTAC
AATTCCAAGGTGCCACCAAAAAAACTTTTTTTAATTAGCCCTC
back to top