EY756104

Overview
NameEY756104
Unique NameEY756104
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length773
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9892 contig Csv1_Contig9892:4..776. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756104 vs. ExPASy Swiss-Prot
Match: CFI_EUSGR (Chalcone--flavonone isomerase OS=Eustoma grandiflorum GN=CHI PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.251e-13
Identity = 59/193 (30.57%), Postives = 88/193 (45.60%), Query Frame = 2
Query:   74 VMVDEIPFPPQIT---TTKPLNLLGHGLTDIEIHFLQIKFTAIGVYLDPEILSHLQ-QWKGKQGSSLAQDDDFFDALVSAPVEKFFRIVVIKEIKGSQYGVQLESAVRDRLXXXXXXXXXXXXXXXXXXXFFQSKYFKK-DSVIAYHFPATSPTAEIVFTSEGKEDSKIKVENANVVEMIKKWYLGGARGVSP 637
            V V+   FPP IT   +TK   L G G+  +EI    +KFTAIG+YLD   +  L  +WKGK    LA   DFF  +++ P EKF ++ +I  + G QY  ++      +                     F+ + F   DS++  H P  S T       +  E S   +EN  + E + +  + G +GVSP
Sbjct:   10 VQVESYLFPPTITPPASTKSFLLGGAGVRGLEIGGNFVKFTAIGIYLDETAIPWLAGKWKGKTAEELADSVDFFADIITGPFEKFTQVTLILPLTGQQYSGKVSENCTAQWKAAGVYTPADGKAIEKFLQVFEPQSFSPGDSILFMHSP-ESLTISFGKAGDIPETSNAVIENKKLSEAVIESVI-GEKGVSP 200          
BLAST of EY756104 vs. ExPASy Swiss-Prot
Match: CFI_ELAUM (Chalcone--flavonone isomerase OS=Elaeagnus umbellata GN=CHI PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.383e-12
Identity = 42/105 (40.00%), Postives = 59/105 (56.19%), Query Frame = 2
Query:   56 TMGTEVVMVDEIPFPPQIT---TTKPLNLLGHGLTDIEIHFLQIKFTAIGVYLDPEILSHLQ-QWKGKQGSSLAQDDDFFDALVSAPVEKFFRIVVIKEIKGSQY 358
            T     V V+ + FPP++    ++K L L G G+  IEI    IKFTAIGVYL+   +  L  +WKGK    L +  +FF  +V+ P+EKF R+  I  + G QY
Sbjct:    5 TKSVTEVQVESVIFPPEVKPPGSSKTLFLGGAGVRGIEIQGKFIKFTAIGVYLEDNAVPSLAVKWKGKSAQELTESVEFFRDIVTGPMEKFTRVTTILPLTGQQY 109          
BLAST of EY756104 vs. ExPASy Swiss-Prot
Match: CFI_GENTR (Chalcone--flavonone isomerase OS=Gentiana triflora GN=CHI PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.806e-12
Identity = 57/195 (29.23%), Postives = 92/195 (47.18%), Query Frame = 2
Query:   74 VMVDEIPFPPQI---TTTKPLNLLGHGLTDIEIHFLQIKFTAIGVYLDPEILSHLQ-QWKGKQGSSLAQDDDFFDALVSAPVEKFFRIVVIKEIKGSQYGVQLESAVRDRLXXXXXXXXXXXXXXXXXXXFFQSKYFKK-DSVIAYHFPATSPTAEIVFTSEG--KEDSKIKVENANVVEMIKKWYLGGARGVSP 637
            V V+   FPP +   ++TK   L G G+  +EI+   +KFTAIGVYL+   ++ L  +WKGK    L+   +FF  +++ P EKF ++ +I  + G QY  ++      +                     FQ++ F   DS++  H P    +  I F   G   E S   +EN  + E + +  + G +GVSP
Sbjct:   12 VKVESYVFPPSVKPPSSTKSFLLGGAGVRGLEINGNFVKFTAIGVYLEESGVAVLSGKWKGKTAEELSDSVEFFTDIITGPFEKFTQVTLILPVTGQQYSPKVAENCAAQWKAAGIYTDADGIAIEKFLQVFQTESFTPGDSILFTHSP---ESLTISFGKNGAIPEVSNAVIENKKLSEAVIESII-GEKGVSP 202          
BLAST of EY756104 vs. ExPASy Swiss-Prot
Match: CFI_VERHY (Chalcone--flavonone isomerase OS=Verbena hybrida GN=CHI PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 3.081e-12
Identity = 58/195 (29.74%), Postives = 89/195 (45.64%), Query Frame = 2
Query:   74 VMVDEIPFPPQIT---TTKPLNLLGHGLTDIEIHFLQIKFTAIGVYLDPEILSHLQ-QWKGKQGSSLAQDDDFFDALVSAPVEKFFRIVVIKEIKGSQYGVQ-LESAVRDRLXXXXXXXXXXXXXXXXXXXFFQSKYFKKDSVIAYHFPATSPTAEIVFTSEGK--EDSKIKVENANVVEMIKKWYLGGARGVSP 637
            V V+ + FPP +    + K   L G G+  +EI    IKFTAIGVYL+ + ++ L  +WKGK    +A   DFF  +V+ P EKF ++  I  + G QY  + +E+ V                       F    +    S++    P  S T  I F+ +G   E     +EN  + E + +  + G +GVSP
Sbjct:   10 VQVESVVFPPAVKPPGSDKTFFLGGAGVRGLEIEGKFIKFTAIGVYLENDAVTSLAAKWKGKTAEEVADSGDFFAEIVTGPFEKFTKVTTILPLTGQQYSEKVVENCVAYWKAIGKFTDAEDEATKKFLQVFKNEMFHPGASILFTQSPQGSLT--ISFSKDGSIPEKENAIIENKQLSEAVLESII-GKKGVSP 201          
BLAST of EY756104 vs. ExPASy Swiss-Prot
Match: CFI_CAMSI (Chalcone--flavonone isomerase OS=Camellia sinensis GN=CHI PE=2 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 3.081e-12
Identity = 60/195 (30.77%), Postives = 87/195 (44.62%), Query Frame = 2
Query:   74 VMVDEIPFPPQIT---TTKPLNLLGHGLTDIEIHFLQIKFTAIGVYLDPEILSHLQ-QWKGKQGSSLAQDDDFFDALVSAPVEKFFRIVVIKEIKGSQYGVQL-ESAVRDRLXXXXXXXXXXXXXXXXXXXFFQSKYFKKDSVIAYHFPATSPTAEIVFTSEGK--EDSKIKVENANVVEMIKKWYLGGARGVSP 637
            V ++   FPP +    T+KP  L G G   +EI    IKFTAIGVYL+   +  L  +WKGK    L    DFF  +VS P EKF ++ +I  + G QY  ++ E+ V                       F    +    S++    P  S T  I F+ +G   E   + +EN  + E + +  + G  GVSP
Sbjct:   12 VQIESHVFPPTVKPPGTSKPFFLGGAGERGLEIQGKFIKFTAIGVYLEDSAIPSLAVKWKGKTAEELTDSVDFFRDIVSGPFEKFTQVTMILPLTGQQYSEKVTENCVAYWKAVGTYTDAEAKAIEKFIEVFKDETFPPGGSILFTQSPLGSLT--IAFSKDGSLPETGTVVMENKQLSEAVLESII-GKHGVSP 203          
BLAST of EY756104 vs. ExPASy Swiss-Prot
Match: CFI3_SOYBN (Chalcone--flavonone isomerase 3 OS=Glycine max GN=CHI3 PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 5.255e-12
Identity = 39/99 (39.39%), Postives = 55/99 (55.56%), Query Frame = 2
Query:   74 VMVDEIPFPPQITTTKPLN---LLGHGLTDIEIHFLQIKFTAIGVYLDPEILSHLQ-QWKGKQGSSLAQDDDFFDALVSAPVEKFFRIVVIKEIKGSQY 358
            V V+ + FPP +      N   L G G+  ++IH   +KFTAI VYL  + LS L  +WK K    L + D FF  +V+ P EKF ++ +IK + G QY
Sbjct:    9 VTVENVTFPPTVKPPCSPNTFFLAGAGVRGLQIHHAFVKFTAICVYLQYDALSFLSVKWKTKSTHQLTESDQFFSDIVTGPFEKFMQVTMIKPLTGQQY 107          
BLAST of EY756104 vs. ExPASy Swiss-Prot
Match: CFI2A_SOYBN (Chalcone--flavonone isomerase 2-A OS=Glycine max GN=CHI2-A PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 6.864e-12
Identity = 38/99 (38.38%), Postives = 55/99 (55.56%), Query Frame = 2
Query:   74 VMVDEIPFPPQITTTKPLN---LLGHGLTDIEIHFLQIKFTAIGVYLDPEILSHLQ-QWKGKQGSSLAQDDDFFDALVSAPVEKFFRIVVIKEIKGSQY 358
            V V+ + FPP +      N   L G G+  ++IH   +KFTAI +YL  + LS L  +WK K    L + D FF  +V+ P EKF ++ +IK + G QY
Sbjct:    9 VTVENVTFPPTVKPPCSPNTFFLAGAGVRGLQIHHAFVKFTAICIYLQYDALSFLSVKWKTKSTHQLTESDQFFSDIVTGPFEKFMQVTMIKPLTGQQY 107          
BLAST of EY756104 vs. ExPASy Swiss-Prot
Match: CFI_CANGE (Chalcone--flavonone isomerase OS=Canna generalis GN=CHI PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.171e-11
Identity = 40/104 (38.46%), Postives = 59/104 (56.73%), Query Frame = 2
Query:   74 VMVDEIPFPPQIT---TTKPLNLLGHGLTDIEIHFLQIKFTAIGVYLDPEILSHL-QQWKGKQGSSLAQDDDFFDALVSAPVEKFFRIVVIKEIKGSQYGVQLE 373
            +++ E+ FPP      ++  L L G G   +EI    + FTAIGVYL+   +S L  +WKGK    LA + DFF  + + P EKF RI ++K + G QY  ++E
Sbjct:   11 LVIGEVTFPPAAAPPGSSSSLFLAGAGERGLEIDRQFVVFTAIGVYLEDLAVSTLGPKWKGKTADDLAGNSDFFRDIFTGPFEKFTRITMVKPLSGQQYSEKVE 114          
BLAST of EY756104 vs. ExPASy Swiss-Prot
Match: CFI_SAUME (Chalcone--flavonone isomerase OS=Saussurea medusa GN=CHI PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 2.608e-11
Identity = 55/196 (28.06%), Postives = 88/196 (44.90%), Query Frame = 2
Query:   74 VMVDEIPFPPQIT---TTKPLNLLGHGLTDIEIHFLQIKFTAIGVYLDPEILSHLQ-QWKGKQGSSLAQDDDFFDALVSAPVEKFFRIVVIKEIKGSQYGVQLESAVRDRLXXXXXXXXXXXXXXXXXXXFFQSKYFKKDSVIAYHFPATSPTAE--IVFTSEGK--EDSKIKVENANVVEMIKKWYLGGARGVSP 637
            + V+ I FPP +     T  L L G G+  +EI    +KFT IGVYL+ + +  L  +WKGK  + L     F+  +V+ P EKF ++ +I  + G QY  ++                            F+ + F   S I +    TSPT    I F+ +G   E + + +EN  + + + +  + G  GVSP
Sbjct:   10 IQVESIVFPPSVKPPGATTTLFLGGAGVRGMEIQGNFVKFTGIGVYLEDKAIPSLAVKWKGKTAAELTDSVQFYRDIVTGPFEKFSQVTMILPLTGKQYSEKVSEMCIGVWKAQGTYTDADTATIEKFLEVFKDENFLPGSSILF---TTSPTGSLTISFSKDGNIPEAATVVLENRKLAQTVIESVI-GEHGVSP 201          
BLAST of EY756104 vs. ExPASy Swiss-Prot
Match: CFI_ALLCE (Chalcone--flavonone isomerase OS=Allium cepa GN=CHI PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 3.406e-11
Identity = 56/197 (28.43%), Postives = 88/197 (44.67%), Query Frame = 2
Query:   59 MGTEVVMVDEIPFPPQITTTKPLNLLGHGLTDIEIHFLQIKFTAIGVYLDPEILSHL-QQWKGKQGSSLAQDDDFFDALVSAPVEKFFRIVVIKEIKGSQYGVQL-ESAVRDRLXXXXXXXXXXXXXXXXXXXFFQSKYFKKDSVIAYHFPATSPTAEIVFTSEG--KEDSKIKVENANVVEMIKKWYLGGARGVSP 637
            +  E    D +  PP  + T  L   G G+  +EI    I FTAIG+YL+ + +  L  +WKGK G  LA   DFF  + + P EKF  + +I  + G QY  ++ E+ V                       F    +    S++  H P  S T +I F+ +G   +D  + +EN  + + + +  + G  GVSP
Sbjct:    7 LDVEGTAFDSVIIPPGSSKTHFLG--GAGVRGLEIGGKFIAFTAIGIYLETDSIPFLADKWKGKTGEELAGSLDFFRDICTGPFEKFTNVTMILPLTGEQYSEKVTENCVAYWKAIGIYTDAEASAVDKFKQAFKPESFPPGSSILFTHTP--SGTLKIAFSKDGSVSKDEGVLIENKALTQAVLESII-GEHGVSP 198          
The following BLAST results are available for this feature:
BLAST of EY756104 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 13
Match NameE-valueIdentityDescription
CFI_EUSGR1.251e-1330.57Chalcone--flavonone isomerase OS=Eustoma grandiflo... [more]
CFI_ELAUM1.383e-1240.00Chalcone--flavonone isomerase OS=Elaeagnus umbella... [more]
CFI_GENTR1.806e-1229.23Chalcone--flavonone isomerase OS=Gentiana triflora... [more]
CFI_VERHY3.081e-1229.74Chalcone--flavonone isomerase OS=Verbena hybrida G... [more]
CFI_CAMSI3.081e-1230.77Chalcone--flavonone isomerase OS=Camellia sinensis... [more]
CFI3_SOYBN5.255e-1239.39Chalcone--flavonone isomerase 3 OS=Glycine max GN=... [more]
CFI2A_SOYBN6.864e-1238.38Chalcone--flavonone isomerase 2-A OS=Glycine max G... [more]
CFI_CANGE1.171e-1138.46Chalcone--flavonone isomerase OS=Canna generalis G... [more]
CFI_SAUME2.608e-1128.06Chalcone--flavonone isomerase OS=Saussurea medusa ... [more]
CFI_ALLCE3.406e-1128.43Chalcone--flavonone isomerase OS=Allium cepa GN=CH... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-003-F06-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756104 ID=EY756104|Name=EY756104|organism=Citrus sinensis|type=EST|length=773bp
TCGTCAACCCACGCGTCCGACTTCATCATTTCCCAATAGTTTCCCACTAA
AGATTACCATGGGCACTGAAGTTGTAATGGTGGATGAAATCCCATTTCCT
CCTCAGATCACCACCACCAAGCCGTTGAACCTTCTGGGTCATGGTTTAAC
AGACATTGAGATACACTTTCTCCAAATCAAGTTCACGGCAATTGGAGTCT
ACTTGGATCCTGAAATTTTGAGTCACTTGCAACAGTGGAAGGGCAAACAG
GGAAGTTCCCTTGCACAAGATGATGACTTCTTTGATGCTCTTGTCTCTGC
TCCAGTAGAGAAATTTTTTAGAATTGTTGTGATCAAGGAGATCAAGGGGT
CACAATATGGGGTTCAGTTAGAAAGTGCGGTGAGGGACAGATTGGCCGAA
GCTGACAAATATGAAGAAGAGGAAGAATCTGCCCTTGAGAAAATCGTTGA
ATTCTTCCAATCCAAGTATTTTAAGAAGGACTCTGTGATTGCTTATCATT
TTCCGGCAACATCCCCTACTGCTGAGATAGTGTTTACAAGTGAAGGAAAG
GAGGACTCAAAAATCAAAGTGGAGAATGCGAATGTGGTTGAGATGATCAA
GAAATGGTACTTGGGTGGAGCAAGGGGAGTGTCTCCTACAACAACATCAT
CTCTAGCCAATACTCTCTCAGCTGAGTTATCAAAATGAAGCACCTCTGCG
CTTTCTAATAAAAGTGCTTCTTCACTTTGGTTTTGGAATTGCTGTAAATT
TGTGGAATTTGGATGACGTGTTT
back to top