EY756103

Overview
NameEY756103
Unique NameEY756103
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length297
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13304 contig Csv1_Contig13304:1..299. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756103 vs. ExPASy Swiss-Prot
Match: PAL2_PEA (Phenylalanine ammonia-lyase 2 OS=Pisum sativum GN=PAL2 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.021e-15
Identity = 36/43 (83.72%), Postives = 40/43 (93.02%), Query Frame = 3
Query:   27 LTREKAISPGEECDKVFTAICQGKIIDPLLECLKEWDGSPLPI 155
            LT EK ISPGEECDK+FTAICQGKIIDPLLECL +W+G+PLPI
Sbjct:  681 LTGEKVISPGEECDKLFTAICQGKIIDPLLECLGDWNGAPLPI 723          
BLAST of EY756103 vs. ExPASy Swiss-Prot
Match: PAL2_PHAVU (Phenylalanine ammonia-lyase class 2 OS=Phaseolus vulgaris PE=3 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.333e-15
Identity = 36/43 (83.72%), Postives = 40/43 (93.02%), Query Frame = 3
Query:   27 LTREKAISPGEECDKVFTAICQGKIIDPLLECLKEWDGSPLPI 155
            LT EK ISPGEECDKVF+A+CQGKIIDPLLECL EW+G+PLPI
Sbjct:  669 LTGEKVISPGEECDKVFSAMCQGKIIDPLLECLGEWNGAPLPI 711          
BLAST of EY756103 vs. ExPASy Swiss-Prot
Match: PAL1_PEA (Phenylalanine ammonia-lyase 1 OS=Pisum sativum GN=PAL1 PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 2.274e-15
Identity = 35/43 (81.40%), Postives = 40/43 (93.02%), Query Frame = 3
Query:   27 LTREKAISPGEECDKVFTAICQGKIIDPLLECLKEWDGSPLPI 155
            LT EK ISPGEECDK+FTAICQGKIIDPLL+CL +W+G+PLPI
Sbjct:  680 LTGEKVISPGEECDKLFTAICQGKIIDPLLQCLGDWNGAPLPI 722          
BLAST of EY756103 vs. ExPASy Swiss-Prot
Match: PAL1_IPOBA (Phenylalanine ammonia-lyase OS=Ipomoea batatas GN=PAL PE=2 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 3.879e-15
Identity = 35/43 (81.40%), Postives = 38/43 (88.37%), Query Frame = 3
Query:   27 LTREKAISPGEECDKVFTAICQGKIIDPLLECLKEWDGSPLPI 155
            LT EK  SPGEECDKVFTA+C+G IIDPLLECLK WDG+PLPI
Sbjct:  664 LTGEKVRSPGEECDKVFTAMCEGSIIDPLLECLKSWDGAPLPI 706          
BLAST of EY756103 vs. ExPASy Swiss-Prot
Match: PAL1_PRUAV (Phenylalanine ammonia-lyase 1 OS=Prunus avium GN=PAL1 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 5.067e-15
Identity = 34/44 (77.27%), Postives = 40/44 (90.91%), Query Frame = 3
Query:   24 YLTREKAISPGEECDKVFTAICQGKIIDPLLECLKEWDGSPLPI 155
            YLT EK  SPGEECDKVFTAIC+GKIIDP+L+CL+ W+G+PLPI
Sbjct:  673 YLTGEKVRSPGEECDKVFTAICEGKIIDPILDCLEGWNGAPLPI 716          
BLAST of EY756103 vs. ExPASy Swiss-Prot
Match: PALY_TRISU (Phenylalanine ammonia-lyase OS=Trifolium subterraneum GN=PAL1 PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 6.617e-15
Identity = 34/43 (79.07%), Postives = 40/43 (93.02%), Query Frame = 3
Query:   27 LTREKAISPGEECDKVFTAICQGKIIDPLLECLKEWDGSPLPI 155
            LT E+ ISPGEECDK+FTA+CQGKIIDPLL+CL EW+G+PLPI
Sbjct:  682 LTGERVISPGEECDKLFTAMCQGKIIDPLLKCLGEWNGAPLPI 724          
BLAST of EY756103 vs. ExPASy Swiss-Prot
Match: PAL2_POPKI (Phenylalanine ammonia-lyase G2B OS=Populus kitakamiensis GN=PALG2B PE=3 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 8.642e-15
Identity = 36/43 (83.72%), Postives = 38/43 (88.37%), Query Frame = 3
Query:   27 LTREKAISPGEECDKVFTAICQGKIIDPLLECLKEWDGSPLPI 155
            LT EK  SPGEE DKVFTAIC GK+IDPLLECLKEWDG+PLPI
Sbjct:  667 LTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLPI 709          
BLAST of EY756103 vs. ExPASy Swiss-Prot
Match: PALY_MEDSA (Phenylalanine ammonia-lyase OS=Medicago sativa PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.129e-14
Identity = 34/43 (79.07%), Postives = 39/43 (90.70%), Query Frame = 3
Query:   27 LTREKAISPGEECDKVFTAICQGKIIDPLLECLKEWDGSPLPI 155
            LT E  ISPGEECDK+F+A+CQGKIIDPLLECL EW+G+PLPI
Sbjct:  682 LTGENVISPGEECDKLFSAMCQGKIIDPLLECLGEWNGAPLPI 724          
BLAST of EY756103 vs. ExPASy Swiss-Prot
Match: PALY_STYHU (Phenylalanine ammonia-lyase OS=Stylosanthes humilis GN=PAL17.1 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.925e-14
Identity = 33/43 (76.74%), Postives = 39/43 (90.70%), Query Frame = 3
Query:   27 LTREKAISPGEECDKVFTAICQGKIIDPLLECLKEWDGSPLPI 155
            LT EK  SPGEECDK+FTA+CQGKIIDPLLEC+ EW+G+PLP+
Sbjct:  672 LTGEKVRSPGEECDKLFTAMCQGKIIDPLLECIGEWNGAPLPL 714          
BLAST of EY756103 vs. ExPASy Swiss-Prot
Match: PAL1_TOBAC (Phenylalanine ammonia-lyase OS=Nicotiana tabacum GN=TPA1 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 2.514e-14
Identity = 34/51 (66.67%), Postives = 40/51 (78.43%), Query Frame = 3
Query:    3 RRPTRPRYLTREKAISPGEECDKVFTAICQGKIIDPLLECLKEWDGSPLPI 155
            R+      LT EK  SPGEECDKVFTA+C G+IIDP+LECLK W+G+PLPI
Sbjct:  664 RKELGTELLTGEKVRSPGEECDKVFTAMCNGQIIDPMLECLKSWNGAPLPI 714          
The following BLAST results are available for this feature:
BLAST of EY756103 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 44
Match NameE-valueIdentityDescription
PAL2_PEA1.021e-1583.72Phenylalanine ammonia-lyase 2 OS=Pisum sativum GN=... [more]
PAL2_PHAVU1.333e-1583.72Phenylalanine ammonia-lyase class 2 OS=Phaseolus v... [more]
PAL1_PEA2.274e-1581.40Phenylalanine ammonia-lyase 1 OS=Pisum sativum GN=... [more]
PAL1_IPOBA3.879e-1581.40Phenylalanine ammonia-lyase OS=Ipomoea batatas GN=... [more]
PAL1_PRUAV5.067e-1577.27Phenylalanine ammonia-lyase 1 OS=Prunus avium GN=P... [more]
PALY_TRISU6.617e-1579.07Phenylalanine ammonia-lyase OS=Trifolium subterran... [more]
PAL2_POPKI8.642e-1583.72Phenylalanine ammonia-lyase G2B OS=Populus kitakam... [more]
PALY_MEDSA1.129e-1479.07Phenylalanine ammonia-lyase OS=Medicago sativa PE=... [more]
PALY_STYHU1.925e-1476.74Phenylalanine ammonia-lyase OS=Stylosanthes humili... [more]
PAL1_TOBAC2.514e-1466.67Phenylalanine ammonia-lyase OS=Nicotiana tabacum G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-003-F05-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756103 ID=EY756103|Name=EY756103|organism=Citrus sinensis|type=EST|length=297bp
TTCGTCGACCCACGCGTCCGCGGTATCTGACACGAGAGAAGGCGATATCA
CCAGGCGAGGAATGTGATAAGGTGTTTACAGCGATTTGTCAGGGAAAAAT
AATTGATCCACTGCTTGAATGTCTTAAAGAATGGGATGGGAGTCCTCTTC
CAATTTGTTAATGCTTTCTTTTATGCCTTTTTTTTTATATATATTTTAAT
GTCGCTTGGAAGGTTAACAAATATAATTCTTCTACTGTGAGGATAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
back to top